KEGG   Bradyrhizobium sp. ORS 285: BRAD285_2814Help
Entry
BRAD285_2814      CDS       T04956                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
bro  Bradyrhizobium sp. ORS 285
Brite
Translation factors [BR:bro03012]
 Eukaryotic Type
  Elongation factors
   BRAD285_2814 (tufB)
 Prokaryotic Type
   BRAD285_2814 (tufB)
Mitochondrial biogenesis [BR:bro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BRAD285_2814 (tufB)
Exosome [BR:bro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAD285_2814 (tufB)
  Exosomal proteins of breast cancer cells
   BRAD285_2814 (tufB)
  Exosomal proteins of colorectal cancer cells
   BRAD285_2814 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2748654..2749844
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYEFPGDKIPIIKGSALAALE
DSDKKLGHDAILELMRNVDEYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRPTQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctaaatttgaacgtaacaagccccactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacgtcgctgacggctgccatcaccaagatcctggccgagacgggc
ggtgcgacgttcactgcctacgaccagatcgacaaggcgccggaagagaaggctcgtggc
atcaccatctcgaccgctcacgtcgagtacgagaccaagaaccgccactacgcccacgtc
gactgccccggtcacgccgactacgtgaagaacatgatcaccggcgctgcccagatggac
ggcgcgatcctggtcgtgtcggccgctgacggcccgatgccgcagacccgtgagcacatc
ctgctcgcccgtcaggtcggcgttcccgcgctggtcgtgttcctcaacaagtgcgacatg
gtcgacgatccggaactgcttgagctggtcgagctcgaggttcgcgagctgctgtcgaag
tacgaattcccgggcgacaagatcccgatcatcaagggttcggcgctcgccgctctggaa
gattcggacaagaagctcggtcacgacgccatcctcgagctgatgcgcaatgtcgacgag
tacattccgcagccggagcgtccgatcgaccagcccttcctgatgccggtcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggtcgtgtcgagcgcggcatcatcaag
gtcggcgaggaaatcgagatcgtcggcatccgtccgacccagaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggctggcgacaacatcggtgcgctg
ctccgcggcaccaagcgtgaggacgtcgagcgcggccaggttctctgcaagccgggttcg
gtcaagccgcacaccaagttcaaggctgaggcgtacatcctcaccaaggaagagggcggc
cgtcacactccgttcttcaccaactatcgtccgcagttctacttccgcacgaccgacgtg
accggcgtcgttcacctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctgcgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system