KEGG   Bradyrhizobium sp. ORS 285: BRAD285_4880Help
Entry
BRAD285_4880      CDS       T04956                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport permease protein (nrtB)
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bro00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BRAD285_4880 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BRAD285_4880 (nrtB)
Transporters [BR:bro02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BRAD285_4880 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4836565..4837473)
Genome map
AA seq 302 aa AA seqDB search
MSMPALTNDSVPKVVSPASASTTASVVTMTPKQPPKAERYVKMAREAAVRVVPPLIVLAL
FLIVWELLCRRAGSALPPPSRVFTDTRELILDPFFDHGGIDKGLFWHLEASLRRVAIGYA
IAAVVGVALGTLIGQSVWAMRGLDPIFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFIT
SVWPIIINTAVGIRNIPQDYRNVAAVVQLNPLEFFAKIMIPAAAPYIFTGLRIGIGLSWL
AIVAAEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIIGFVLDRLIAVVGKIVTRGTA
TN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgcccgcgttgaccaatgacagcgtgcccaaggtcgtttcgcctgcgtcagca
tccaccacggcgtcggtggtgacgatgacgccgaagcagccgccgaaggccgagcgttat
gtgaagatggcccgcgaggccgcggtgcgcgtggtgccgccgctgatcgtgctggcgctg
ttcctgatcgtctgggagctgctctgccggcgcgccggctcggcactgccgccgccgtcg
cgcgtgttcactgatactcgcgagctgatcctcgatccgttcttcgatcatggcggcatc
gacaagggcctgttctggcatctcgaagccagtctccgccgcgtcgcgatcggctacgcc
atcgccgcggtcgtcggtgtggcgctgggcaccctgatcgggcagtcggtctgggcgatg
cgcggtctcgatccgatcttccaggtgctgcgcacgatcccgccgctcgcctggctgccg
ctgtcgctcgccgcgttccgcgacggtcagccctcggcgatcttcgtcatcttcatcacc
tcggtgtggccgatcatcatcaacaccgcggtcggcatccgcaacatcccgcaggactac
cgcaacgtcgccgccgtcgtgcagctcaatccgctggagttcttcgccaagatcatgatc
ccggcggccgcgccctacatcttcaccggcttgcgcatcggcatcggcctgtcctggttg
gcgatcgtcgcggcggagatgctgatcggcggcgtcggcatcggcttcttcatctgggac
gcgtggaattcctcgcatatcagcgagatcattctggcgctgttctatgtcggcatcatc
ggcttcgtgctcgaccggctgatcgccgttgtcggcaagatcgtcacccgcggcaccgcg
acgaactga

DBGET integrated database retrieval system