KEGG   Brassica rapa (field mustard): 103839353Help
Entry
103839353         CDS       T03449                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
brp  Brassica rapa (field mustard)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103839353
   00020 Citrate cycle (TCA cycle)
    103839353
   00620 Pyruvate metabolism
    103839353
Enzymes [BR:brp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103839353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
A9
AA seq 479 aa AA seqDB search
MAASSSFLSTASLSNPKSTISFASSVSPAPIPSLRRVVFRSPSSHRRVMTVRSKIREIFM
PALSSTMTEGKIVSWIKTEGEKLAKGESVVVVESDKADMDVETFYDGYLAAIVVGEGETA
PVGAAIGLLAETEAEIEEAKNKAASKPSSSAVVPSPPPATSSPAPAIAQPSPAAAASDGP
RKTVATPHAKKLAKQHKVDIGSVAGTGPFGRITASDVEAAAGIAPTVTPPPPPPPPAAAP
TPTAKATTTSSPPLLPDASIVPFTAMQSAVSKNMIESLSVPTFRVGYPVNTDALDALYEK
VKPKGVTMTALLAKAAGMALAQHPVVNASCKDGKSFSYNSNINVAVAVAINGGLITPVLQ
DADKLDLYLLSQKWKELVGKARNKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAI
MAVGASKPTVVADKDGFFSVKNKMLVNVTADHRIVYGADLAAFLQTFAKIVENPDSLTL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcttcttcgtttttatcaacagcttcgctatccaatcccaagtccaccatt
tcattcgcttcctccgtctcccctgctcccatcccttccctccgccgcgtcgttttccgc
tctccgtcttctcaccgcagagtaatgacggtccgatccaagattcgcgagattttcatg
ccggcgctatcctccaccatgacggaaggcaaaatcgtctcctggatcaaaaccgaaggc
gagaaactcgctaaaggagagagtgtcgtcgttgttgagtccgataaggccgatatggac
gtggaaaccttctacgacggttatctcgccgcgatcgtcgtcggagaaggagaaacagct
ccggtaggcgctgcaatcggattgctggcggagactgaggctgaaatcgaagaagctaag
aacaaagccgcctcgaaaccttcctcctccgccgttgttccatctcctcctccagctact
tcatcccccgctccggcgatcgctcagccttctccggcggcagcggcgtcagatggtccg
aggaaaaccgtagcgacgccgcatgctaagaagctcgcgaagcagcacaaagtggatatc
ggatccgttgcaggaactggaccattcggtaggatcacggcttccgatgtggaggcggcg
gctggaatagctcccaccgtgacaccaccgcctcctcctcctcctcctgcagctgcacca
acaccaacagcgaaagctaccaccactagctcgcctcctctattgcctgacgccagcatc
gtccccttcacagcaatgcaatcagcagtatccaaaaacatgattgagagtctctccgtt
ccaacgttccgtgttggttacccagtgaacactgatgcactcgacgcactctacgagaag
gtgaagccaaagggtgtgacaatgactgctttattggctaaagctgcagggatggctctt
gctcagcatcctgtggtgaacgctagctgcaaagatggcaagagttttagttacaatagt
aacattaacgttgcggttgctgttgccatcaatggcgggttgattacgcctgttctacaa
gatgctgataagttggatttgtacttgttatctcaaaaatggaaagagctggtggggaaa
gctagaaacaagcaattgcaacctcatgaatacaactctggaactttcactttatcgaat
ctcggtatgtttggagtggatagatttgatgctattcttcctccaggacagggtgctata
atggcggttggagcttcgaaaccaactgtagttgctgataaggatgggttcttcagtgtg
aaaaacaaaatgctggtgaatgtgacagcagatcatcgtattgtctacggagctgatttg
gctgctttccttcaaacctttgcaaagatcgttgagaatccagatagcttgaccttgtag

DBGET integrated database retrieval system