KEGG   Brassica rapa (field mustard): 103841329Help
Entry
103841329         CDS       T03449                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103841329
Enzymes [BR:brp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103841329
Chromosome and associated proteins [BR:brp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103841329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 103841329
NCBI-ProteinID: XP_009116100
LinkDB All DBs
Position
A9
AA seq 631 aa AA seqDB search
MTSHIPMVIPKPEPVTDSSPQTPIPPSSFFNFNTTTTQSPLEPNLYTEFTNVAETFRSAF
AQRLKRHEDVTVLDSLTGAIVPVPEEQDPDPDPVSYPSQSLKPRKPQERSSELVRITDVG
PEGERQFREVVRKTRMIYDSLRIFLILEETREVLGRRRGRPDSKAASMMKERFLWLNRDK
RIVGSIPGVQVGDIFFFRLELCVMGLHGQTQAGIDYLIGSRSSNGEPIATSVIVSGGYED
DDDQGDVIIYTGHGGQDKLGRQAEHQKLEGGNLAMERSMYYGIEVRVVRGFKYENAVSSK
VYVYDGLFRIVDSWFDVGKSGFGVFKFRLERIGGQVEMGTSVLKFAKTLKTNPLSVRPSG
YISFDISNRKENAPVYLFNDVDDDQEPLYYEYLATTSFPRGILGGSNGDNASGCECVSGC
SSGCICERKNGGEFAYDYNGNLIRMRPLVHECGPGCKCPPTCRNRVTQKGLRSRLEVFRS
VETGWGVRCLDILHAGAFICEYVGVALTREQANILTMNGDTLVYPARFCSDRWKDWGDLS
QVFPDYERPSYRQIPPVDYAMDVSKLRNVACYISHSNDSNVIVQMVLHDHNNLMFPRVML
FAAENIPPMTELSLDYGVSDDEWSPKLAICN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcacatacctatggtgatccctaagccggagccagtcactgattcctcccca
caaactccgattccaccctcatccttcttcaatttcaacaccaccaccacccaatctccc
ctcgaacctaacttgtacaccgagttcaccaacgtcgccgagactttccgctccgccttc
gcacagcgcctcaaacgccacgaggacgtcacggtcctcgattccctaaccggcgccatc
gtacccgttcccgaggagcaagatccggatccggatccggtcagttacccttcgcagtcc
ctcaagccgcgtaaacctcaggagcgctcgtctgagctcgtgaggatcaccgacgtcggc
cccgagggagagaggcagtttcgggaagtggtgaggaagacgaggatgatctacgattct
ctccggatcttcttgatcctcgaggagactcgtgaagtgctcggaaggaggagaggcagg
cccgatagcaaagccgcctcgatgatgaaagagcgtttcctttggcttaatcgggacaaa
cgcatcgtcggttcgatccccggcgtccaggtcggagacatcttcttcttcaggctcgag
ctctgcgtcatggggttgcacggacagacgcaggctgggattgactatctcattggctcc
cgcagctctaacggagagccgatcgccaccagcgtgattgtctcaggtggttatgaggat
gatgatgatcaaggggatgtgattatctacacgggacatggagggcaggacaagctcggg
aggcaggctgagcatcagaagctcgaaggtgggaatctcgctatggagaggagtatgtac
tacgggattgaagtgagagtggttagaggttttaagtacgagaacgctgtttctagcaag
gtttatgtttatgatgggctgtttaggatcgttgattcttggttcgatgtggggaagtcc
gggttcggtgtttttaaatttaggctggagaggatcggagggcaggtggagatggggacg
tcggtgttgaagttcgccaagacgcttaaaaccaaccctttgtctgtgagaccgagcggg
tacatcagcttcgatatctccaacaggaaggagaacgctcctgtgtatttgttcaacgac
gttgatgacgatcaggagccgttgtactatgagtatctcgccactacttctttccctcgc
ggcatattgggtggtagtaatggtgataatgcgagtggatgcgaatgtgtcagcggttgt
agcagcggctgcatctgcgagaggaagaacggtggcgagtttgcttatgattacaacggg
aatttgataagaatgaggccgttggtgcatgagtgtggaccggggtgtaagtgccctccg
acgtgtcggaaccgcgtgacgcagaaggggttgaggagtagactcgaggtgtttaggtcg
gtggagactggctggggggttcggtgtttggatatattgcacgctggcgcttttatttgc
gagtatgttggggttgctttgacgagggagcaagccaacattctgacaatgaacggcgat
actttggtgtaccctgctcggttttgttctgataggtggaaagattggggagatttgtct
caggtgtttccggattacgagcggccttcgtatcgtcagatccctcctgttgattatgcg
atggatgtttcaaagttgaggaacgttgcttgttacataagccacagtaatgattcgaat
gtgattgtacagatggtactgcatgatcacaacaatctgatgttccctcgtgttatgctt
ttcgctgctgagaacattccgcccatgactgagctcagccttgattatggagtctctgat
gatgaatggagccccaagctcgccatttgtaattaa

DBGET integrated database retrieval system