KEGG   Brassica rapa (field mustard): 103871561Help
Entry
103871561         CDS       T03449                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03030  DNA replication
brp03410  Base excision repair
brp03420  Nucleotide excision repair
brp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:brp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103871561
   03410 Base excision repair
    103871561
   03420 Nucleotide excision repair
    103871561
   03430 Mismatch repair
    103871561
Enzymes [BR:brp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103871561
    6.5.1.6  DNA ligase (ATP or NAD+)
     103871561
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103871561
DNA replication proteins [BR:brp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103871561
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103871561
DNA repair and recombination proteins [BR:brp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103871561
   NER (nucleotide excision repair)
    Other NER factors
     103871561
   MMR (mismatch exicision repair)
    Other MMR factors
     103871561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103871561
NCBI-ProteinID: XP_009148073
LinkDB All DBs
Position
A6
AA seq 772 aa AA seqDB search
MLTIRSSNHFRCISSLFTKTLNPKFSSVSLSFTRPAPHRAMSSSRPSAFDALMSNARASA
AKKKTPQASNPPRSPNKRKIEKTQDSDLVKTEASDSAKPGSDSPSIAEDSKKGAKKSRSL
TQTDKIEEMKSKIALLKKKPGEFDPERVSCWEKGERVPFLFIALAFDLISAESGRIVITD
ILCNMLRTVIATTPDDLVATVYLAANEIAPAHEGVELGIGEGSVIKAISEAFGRTESQVK
KLNTELGDLGLVAKGSRSSQTMMFKPESLTVVKVFNTFRQIAKESGKDSTEKKKDRMKAL
LVAATDCEPLYLTRLLQAKLRLGFSNQTVLAALGQAAVYNEEHSKPPPNTKSPLEEAAKI
VKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPMLAKPTKGVGEILNKFQDTV
FTCEYKYDGERAQVHCMEDGTFEIYSRNAERNTGKYPDVALALSRLKKPSVKSFILDCEV
VAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDMLYLNGQQLIQENLNIRREKL
YESFEEDPGYFQFATTLTSSDIDEIQKFLDASVDIGCEGLIIKTLNSDATYEPAKRSNNW
LKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVFGAFLLACYDADKEEFQSICKIGTGFSE
AVLEERSTSLRSRVIATPKQYYRVGDSLNPDVWFEPTEVWEVKAADLTISPVHRAATGIV
DPDKGISLRFPRLLRVREDKKPEEATSSEQIADMYQAQKHNHPSNDAKGEDD
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgattcgatcatcgaatcacttccgatgcatatcttccctcttcactaaaacc
ctaaaccccaaattctcctccgtctcgctctcctttacccgcccagctccccacagagcc
atgtcttcttcacgcccctccgcattcgacgctctcatgtccaacgctcgcgcatccgcc
gccaagaagaagaccccacaagcctccaacccgcctcgctcgccgaacaagaggaaaatc
gaaaaaacccaagactccgatttggtcaagaccgaagcttccgattccgcgaaacccgga
tcggattcaccttcaatcgcggaggattcgaagaagggtgcgaaaaagtctaggtctttg
acccagacggataagatcgaggaaatgaagagcaaaatcgcgttgctgaagaagaagccc
ggcgagttcgatccggagagagtgtcgtgttgggagaaaggggagagagttccgtttctt
tttatcgcgttggcgtttgatttgatctcagctgaaagtgggcggattgtgattactgat
attttatgtaatatgttgagaactgttattgccactactcctgatgatttggtggctact
gtttaccttgcggcgaacgagattgctcctgcgcatgaaggggttgagttggggattggt
gaagggtctgttatcaaggccatctctgaggcttttggtagaacggagtctcaggttaag
aagctaaacacggagcttggagacttggggcttgtagctaaaggaagccgttcgtctcag
actatgatgttcaagccagagtcattgactgttgtcaaggttttcaacacatttcgacaa
attgctaaggaaagtggaaaagatagtacagaaaagaagaaggaccggatgaaggcactc
ctcgtggcagcaacggactgtgaacctctttacttgactcgtctacttcaggcaaaattg
cggttagggttttcaaaccagacggtcttagctgccttgggacaagcagctgtatataat
gaagagcactctaagccacctcctaataccaagtctcctttagaagaggctgcgaagatt
gttaaacaagtattcactgtgcttcctgtctatgacattattgtccccgctcttttatct
ggtggtgtgtggaatctccctaaaacttgtaactttacactcggtgttccaatcggacca
atgcttgcaaaaccaacaaaaggtgtaggtgagatactgaataaattccaagacaccgtc
ttcacatgcgagtacaagtatgatggagaacgtgcacaggtacattgtatggaggatggt
acattcgagatatatagtcgaaatgccgaaagaaacactgggaagtaccctgatgttgct
cttgcgttgtcaagattaaagaagccttctgtgaaatcttttattctggattgcgaagtt
gttgctttcgacagggagaaaaagaaaattctgccatttcagattttgagcactcgagcc
cgtaaaaatgtgaatgtcaacgatatcaaagttggcgtatgcatctttgcttttgacatg
ttatatcttaatggccagcaacttatccaggagaatcttaatattcgccgagagaagcta
tacgaatcatttgaggaagatcctggatatttccagttcgcaacaactctaacgtccagc
gatatagatgaaatacaaaagtttcttgatgcgtccgttgatattggctgtgaagggttg
atcattaaaacattgaattcagatgctacatatgagcctgcaaagcgatcaaataattgg
ctaaaactgaagaaagactacatggacagtattggggactctgtggatcttgtaccaatt
gctgctttccatggacgtggcaaacgcacaggtgtctttggtgcatttttactagcttgc
tacgatgctgataaggaagagtttcaaagcatttgtaaaataggtactggattttctgaa
gctgtacttgaagagcggtctaccagtcttcgctctagagtgattgctactccaaaacaa
tactaccgagttggagacagcctcaatccagacgtttggttcgaacccactgaggtctgg
gaagtaaaggcagctgacttgacaattagccctgtacatcgtgcagctaccggcattgtg
gaccctgataagggaatttctctacgttttccccgtttgctacgtgtacgggaagacaag
aagccagaggaagcaacatcatctgagcagattgctgatatgtaccaagctcagaaacac
aaccatccgagcaatgatgccaaaggtgaagacgactga

DBGET integrated database retrieval system