KEGG   Brachybacterium sp. VR2415: CFK39_12080Help
Entry
CFK39_12080       CDS       T04950                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
brv  Brachybacterium sp. VR2415
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:brv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CFK39_12080
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CFK39_12080
Enzymes [BR:brv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CFK39_12080
Bacterial toxins [BR:brv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CFK39_12080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2700694..2701827)
Genome map
AA seq 377 aa AA seqDB search
MISLGSSPAPVPDAPVPHTVLARAGEGPWPRYRIVGLVHLGDGHLLAGFDGRETGQDVPD
PTGLVQRRSLDGGRTWGPFEELRDADRTGRHWYCDPSYLHDPASGRVLVFHTHAKDRGVW
DAVAGADDADRDVMGSAVGISEDAGRSWEFRSVTEVAAPPALIRTAFPTSGAGIVLRRGP
YAGRLLQPYCGWFHAAAASPAAGGEVVRSYVLYSDDHGESWQRGEPVGEDMDETTIVELS
DGRVLLNSRDHARGGHRRIAVSADGGQSWADRGVDPQFVDPGNNAQLAGRFPEAPSEDPR
ARELLFTGAHDRFARIRGTLSTSHDDGQTWQEALVFEPGPLDYSVVQALDDEAIGILWEV
ESREIRFARLEAEQLRA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatctccctcggctcgtccccggcgcccgtgcccgacgcccccgtgccccataccgtg
ctcgcccgcgccggggaggggccctggccccgctaccggatcgtgggcctggtccacctc
ggcgacgggcacctgctcgccggcttcgacggccgggagaccggccaggacgtccccgac
ccgacggggctggtgcagcggcggtctctggacggcggccgcacctggggccccttcgag
gagctgcgggacgcggaccgcacaggccggcactggtactgcgaccccagctacctccac
gatcccgcctcgggacgggtgctggtcttccatacccatgcgaaggatcgcggggtgtgg
gacgcggtcgcgggcgccgatgacgcggaccgggacgtgatgggctccgccgtcggcatc
tccgaggacgcgggccgcagctgggagttccgttcggtgaccgaggtcgccgctcccccg
gcgctgatccgtaccgccttccccacctccggggcgggcatcgtgctgcggcgcggcccg
tacgcggggaggctgctgcagccgtactgcggctggttccatgccgccgccgcgtccccg
gcggccggcggcgaggtggtgcgctcctacgtgctctactccgacgaccacggcgagtcc
tggcagcgtggagagccggtcggcgaggacatggatgagaccacgatcgtggagctctcc
gatggccgagtgctgctgaactcgcgcgatcatgcccgcggcgggcatcggcgcatcgcc
gtctccgccgatggcgggcagagctgggcggatcggggcgtcgatccgcagttcgtggac
cccggcaacaatgcccagctcgccggacggttccccgaggccccgagcgaggacccgcgg
gcacgcgagctgctgttcaccggcgcccacgaccgcttcgcccggatccgaggcacgctc
agcacctcgcacgatgacgggcagacctggcaggaggcgctggtgttcgagcccgggccg
ctggactactccgtggtccaggcgctggatgacgaggcgatcgggatcctctgggaggtc
gagtcgagggagatccgcttcgcccggctcgaggccgagcagctgagggcctga

DBGET integrated database retrieval system