KEGG   Brachybacterium sp. P6-10-X1: BH708_16785Help
Entry
BH708_16785       CDS       T04713                                 

Definition
(GenBank) hypothetical protein
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:brx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BH708_16785
Enzymes [BR:brx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BH708_16785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4350 GHL6
Motif
Other DBs
NCBI-ProteinID: APX35005
UniProt: A0A1P8NL21
LinkDB All DBs
Position
3801065..3803182
Genome map
AA seq 705 aa AA seqDB search
MLYGVSYYPEYMPHDRLAEDVAMMRGAHLTYVRLADSIWALAEPAPGRIDVEMLGPTLDA
LHGAGIRVVLCTPTYAIPAWMATEHPEIMLRRADGTPWPYGDRQNADITHPGYRFYAERI
IRALMDRWADHPAVIGVQVDNETGGRAIHSPAATAEFRRRLGEKFGSVERLNEVWGLAFW
SHRLSDLSQLWEPGDRSGGGGNSNPGYDLEWRRFQADLVAEFLDWQAGIVREYLREDQFV
THDCVGGHGLPHADRHRIGQVVDVPAENFPHHSQDALAHPPRGTHPPTYHDPSGVHGAIQ
LFQRADMARAGGHQNFLVTEINPLSVGGSAHNFPGYDGQWRLAAYTCISRGANAVSYWHW
HSLHYGSETYSHGVLGHDLQPNRNLAEIARTGEELSRVGDDLTDLSAEADVCLLYSQDSR
YLLEFEPFLAVPGTAEGDRRSYQRVVDAFYRGFFDARAQLTVRDVDAGPADRVDLADLSE
YALVVAPTLYSADDATAARLLEYAAGGGHLVLGPRSGYMDEFGRARAERGPGPLREGVGA
GYSLYSTLENPLPLTADGTLDLEEGAAAVGWMDELELEGAEPLAHYEHHTFTRHPAIVTH
ARGRGRITYLGTVPNAELARSVARWALDDAGIDVLGTGLPEPVRVTRARRPDGVRLWFVT
NWSHEPATVPAPAAGRSLLADQTVAAGAPLALDPWDLAILEEDPG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgctctacggcgtctcctactaccccgaatacatgccgcacgaccgcctcgccgaggac
gtcgcgatgatgcgtggggcacacctgacctacgtgcgcctggcggactcgatctgggcg
ctcgccgaacccgcacccggccgcatcgacgtcgagatgctcggccccaccctcgacgcc
ctccacggggcagggatccgcgtggtgctgtgcacccccacctatgcgatccccgcctgg
atggcgaccgagcaccccgagatcatgctccgccgggccgacggcaccccctggccctac
ggagaccggcagaacgccgacatcacccaccccggctaccgcttctacgccgagcgcatc
atccgggcgctgatggatcgctgggccgaccaccccgcggtgatcggcgtgcaggtcgac
aacgagaccggcgggcgcgcgatccactccccggccgccaccgccgagttccgccgtcgc
ctgggggagaagttcgggagcgtggagcgcctgaacgaggtctggggcctggccttctgg
tcccaccggttgagcgacctctcccagctgtgggagcccggggaccgctccggcgggggc
gggaactccaatcccggctacgacctcgaatggcgccgcttccaggcagatctcgtcgcc
gagttcctcgactggcaggccggcatcgtgcgcgagtacctgcgcgaggaccagttcgtc
acccacgactgcgtgggcgggcacgggctcccgcacgcggaccggcaccgcatcggacag
gtggtcgacgtgcccgcggagaacttcccgcaccacagtcaggacgccctggcccatcct
cccaggggcacccatccgcccacctaccacgacccctccggcgtccacggcgccatccag
ctgttccagcgcgcggacatggctcgcgccggcggccaccagaacttcctggtcaccgag
atcaatccgctcagcgtcggcggcagcgcccacaacttccccggctacgacgggcagtgg
cgactggccgcctacacctgcatctcccgcggggcgaacgcggtctcgtactggcactgg
cacagcctccactacggctcggagacctactcccacggggtgctcggacacgatctgcag
cccaaccggaatctcgccgagatcgcccgcaccggcgaggagctctcccgcgtgggcgat
gacctcaccgatctgtccgccgaggcggacgtctgcctgctgtactcccaggactcccgc
tacctgctcgagttcgagccgttcctggccgtgccgggcaccgccgagggcgaccgccgt
tcctaccagcgcgtggtcgatgccttctaccgaggcttcttcgacgcccgcgcccagctg
acggtgcgcgacgtcgacgccggcccggcagaccgcgtcgacctcgcagacctctccgaa
tacgccctcgtcgtcgcccccaccctctacagcgccgacgacgccaccgccgcgcggctg
ctggagtacgcggccggcggcggccatctcgtcctcggcccccgctcggggtacatggac
gagttcggcagggctcgtgccgagcgcgggccgggcccgctgcgcgagggggtcggcgcc
ggctactcgctgtactcgaccctggagaacccgctgccgctgacggccgacggcacgctc
gatctcgaggagggcgccgccgcggtcggctggatggacgagctcgagctcgaaggcgcc
gaaccgctcgcccactacgagcaccacaccttcactcgccatccggcgatcgtcacccac
gcccgcggccgcggccgcatcacctacctcggcacggtgccgaacgcggagctggcgcgc
tccgtcgcgcgctgggccctggacgacgccgggatcgacgtgctcggcacaggactgccc
gagcccgtccgcgtcacccgcgcccgtcgacccgacggtgtgcggctgtggttcgtgacc
aactggtctcacgagccggcgaccgtgccggcacccgccgcgggacgctccctgctggcg
gatcagacggtcgccgccggcgcgccgctggccctcgacccctgggacctggccatcctc
gaggaggatcccggatga

DBGET integrated database retrieval system