KEGG   Brachybacterium sp. VM2412: CFK38_15420Help
Entry
CFK38_15420       CDS       T05108                                 

Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
brz  Brachybacterium sp. VM2412
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:brz00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CFK38_15420
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CFK38_15420
Enzymes [BR:brz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CFK38_15420
Bacterial toxins [BR:brz02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CFK38_15420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3428780..3430027
Genome map
AA seq 415 aa AA seqDB search
MDARMTRRGLLGTAAAVTALGTGATAATADGTRSPAGSAALPPVKDHGRRQGTYQEQVLA
APGDWGVLNFRIPALAVAPNGDLLAAFDKRPVHGDSPAPNSIWQRRSRDGGLTWEEPTVV
RAGLESEVPGEKLGYSDPSYVVDTETGTIFLFCVFSKDTGVWNSEYGNDDADRRVMSANL
SVSHDSGETWEHRSVTEVVKPENCRAMFASSGAGIQLRYGKHQGRLIQQYAGWFRNDAGG
EDVSAYSVYSDDHGETWTMGTPVGTQMDENKVAELSDGTVMLNSREHVRTGHRWVALSHD
GGETYQDLHRDPSLVDPGNNAQLTRAYPEAPQGSAKAKVLLFSHADHVPDARLNGTIEIS
TDDGAGWARKRVFAPGACQYSVIIPVGRDEFLLAYEGDQETIMIARLDMAWILSR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacgtatgacccgccgcggcctgctcggcacggccgccgctgtgaccgctctg
ggcaccggtgccaccgccgcgaccgccgatggcacccgctctcctgccggatccgccgcc
ctgcctcccgtgaaggaccacggccgccgtcagggcacctaccaggagcaggtgctcgcc
gcgcccggcgactggggagtgctgaacttccgcatcccggccctggccgtggccccgaac
ggcgacctgctggccgccttcgacaagcgtcccgtgcacggcgactcccccgccccgaac
tcgatctggcagcgtcgctcgcgcgatggtgggctcacctgggaggagcccacggtggtg
cgtgctggcctggagtccgaggtccccggggagaagctcggctactccgatccctcctat
gtggtggacaccgagaccgggacgatcttcctgttctgcgtgttctccaaggacaccggt
gtgtggaacagcgagtacggcaacgacgacgcggatcgtcgcgtgatgagcgcgaacctc
agcgtcagccacgactcgggcgagacctgggagcaccgctcggtcaccgaggtcgtcaag
cccgagaactgccgggccatgttcgcctcctccggcgccggcatccagctgcgctacggg
aagcatcagggccgcctgatccagcagtacgcgggctggttccgcaacgatgccggcggc
gaggacgtctcggcgtactcggtctactccgacgaccacggggagacctggaccatgggc
acgcccgtgggcacccagatggacgagaacaaggtcgccgagctctccgacggcacggtc
atgctgaactcccgcgagcacgtgcgcaccgggcaccgctgggtggcgctcagccacgac
ggcggcgagacctaccaggatctgcaccgggatccgagcctggtcgatccgggcaacaac
gcacagctcacccgcgcctaccccgaggcgccgcagggctccgcgaaggcgaaggtgctg
ctgttctcccacgcggaccacgtccccgatgcgcgcctgaacggcacgatcgagatctcg
accgacgacggtgccggctgggcgcgcaagcgggtgttcgcaccgggcgcctgccagtat
tctgtgatcatccccgtgggccgtgacgagttcctcctcgcctacgagggtgaccaggag
accatcatgatcgcgcgtctggacatggcgtggatcctgtcccgatga

DBGET integrated database retrieval system