KEGG   Bacterioplanes sanyensis: CHH28_11200Help
Entry
CHH28_11200       CDS       T04982                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bsan  Bacterioplanes sanyensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHH28_11200
  Energy metabolism
   00680 Methane metabolism
    CHH28_11200
Enzymes [BR:bsan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CHH28_11200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2404802..2407435
Genome map
AA seq 877 aa AA seqDB search
MSELDALLRDKVRLLGNLLGQTIARHQGDEMLQRIEDIRQQAKAARSGEEHERDRLLAML
KTIPDDAVLPVVRGFNQFLNLANIAEQQHGASWRRAEFLNDDVDQLFDDLLNRLEHNGVR
GSDLCQQVADVDIELVLTAHPTEVTRRTLIQKYDEISQLLQQRDDLRDDHPQLQAIEQRL
SVLVEEIWQTDEIRRVRPTAVDEAKWGFAVIENSLWHAIPQLTRHLDEQLLARGSEALPL
TAAPVRIASWMGGDRDGNPNVTSRVTREVLFLSRWMAADLFLRDIHHLSGQLSMTEASSE
LRQAYPEDEPYRACMHQLRERLKATRRWAEAKASGKKTDKQPLLNDDELLQPLLLCYHSL
VSQGMKTLADGHLLDTIRRVACFGLTLVKLDVRQESTRHSDVMAELCDFYQWGDYYSWSE
EEKQALLLRELQSRRPLFPRHWQPSDNAQEVLNTMKVLAAEEGAGVSCYIISMASEPSDI
LTVALLLQECGVRHALPIVPLFETLNDLELATPRMKKLWQVPWYQQYCQQRQQVMIGYSD
SSKDAGQLAAVWAQYQAQENLTQAAEEAGIRLRLFHGRGGTVGRGGGPAHSAILAQPPGS
VKGGLRVTEQGEMIRFKFGLPAVALRNLKVYVSSVLEANLLPPAAPEPQWRSLMETLAQD
GVTSYRAMVRDEPDFVTYFRAATPEMELGKLALGSRPARRKAGGGIETLRAIPWIFAWTQ
MRLMLPAWLGSDAALHASIGRNEIDTLHTMYEKWPFFRTYIDMLEMVLSKSDLAIVTYYE
RRLVPVELQPLGSLLRQRLEQARELVLAIKQQPHLLHDNPALQYSMDVRNPYTDPLHYLQ
SELLYRERQAGDSSHEQVEQALKVTMAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactagatgccctattgcgtgataaggtgcgcttgttaggcaatttgttgggg
caaaccatcgcccgccatcaaggcgatgagatgttgcagcgtatcgaagacattcgccag
caagccaaagcagcgcgcagcggtgaagaacacgaacgcgatcgtctgttggcgatgttg
aaaaccattccagacgatgctgtgttgcctgtagtacgcgggtttaatcaattccttaat
ctggccaatattgccgaacagcagcacggtgctagctggcggcgggcagaatttctcaat
gatgatgtcgatcagctgtttgatgatttattgaatcgcctggaacacaacggtgtgcgc
ggtagcgatttgtgccagcaagtggcggacgttgatattgaactggtgcttacggcgcac
ccgactgaggttacacgtcgtaccttgatccagaaatacgacgaaatttcgcaattatta
caacaacgtgacgacttgcgcgacgatcacccgcagttgcaagccattgagcagcgtttg
tcggtattggtggaagaaatctggcagacggatgaaattcgtcgtgttcgtcctacggct
gtggatgaagccaagtggggatttgcggtgatcgaaaactcactgtggcacgctattcca
caactgacgcgccatctcgatgagcaattgttggcacgcggcagcgaagccttaccgctg
acggctgcaccagtgcgcatcgcctcgtggatgggcggtgatcgtgatggtaatcccaat
gtgacgtcccgcgttactcgtgaagtattgtttttgtcgcgctggatggcggcggattta
ttcctgcgtgacattcaccatttaagcggtcagctatcgatgaccgaagccagcagcgaa
ttacgtcaagcgtatcctgaagatgaaccttatcgcgcctgcatgcatcagttgcgagaa
cgcttaaaagcgacacgccgttgggctgaggccaaggcgtcgggaaagaaaaccgataaa
cagccattattgaacgacgacgaactattgcagcctttgttgttgtgttaccacagtttg
gtcagtcaaggcatgaaaaccttggctgacggccatttgcttgacaccattcggcgggtc
gcctgctttggcttgactttggtgaagctggatgtgcgacaggagtcgactcgccacagc
gatgttatggccgaactgtgcgatttctatcagtggggcgattattacagttggagcgaa
gaggaaaagcaggcattgctgttgcgggaactgcaatcacgccgtccgctgtttcctcgc
cactggcagccatcagacaatgcccaggaagtgctgaacaccatgaaggtgctggccgct
gaagaaggggctggagtatcttgttacattatttctatggccagtgagccgtctgatatc
ttgaccgtggcgttattgctgcaggaatgtggcgttcgccatgcgttgcccatcgtgcct
ttgttcgaaaccttaaatgacctagagctggccacgccgcggatgaaaaaattgtggcaa
gtgccttggtatcagcagtattgccagcagcgccaacaagtcatgattggttattccgac
tcctccaaagacgccggacaattagccgctgtgtgggctcagtaccaagcgcaagaaaat
ctgacgcaagcggcagaagaggccggcattcggttgcgtttatttcatggtcgcggcgga
acggtggggcgcggtggcggcccggcgcacagcgctatcttggcgcaaccgccaggttcc
gtgaaaggtggcttacgcgtgactgagcaaggcgagatgattcgctttaagtttggtttg
ccagcagtggctttgcgtaacttaaaggtctatgtgtcgtcggtattggaggcaaactta
ttgccaccggctgcccctgagccgcagtggcgttcgttaatggaaacgctggcgcaagat
ggtgtgacttcttaccgtgccatggtcagagacgagcctgacttcgtcacctatttccgc
gccgcaacgccagagatggaattgggtaaattagccctcggtagccgaccggcgcgccgc
aaagccggcggtggcatcgaaaccttgcgcgccattccctggatctttgcctggacgcaa
atgcgtttaatgttaccggcttggttaggctctgacgccgcgctgcatgccagtattggt
cgcaacgaaattgacaccctgcatactatgtatgaaaagtggccattctttcgcacctac
atagatatgttggaaatggtgttgtcgaaatccgacttagccattgtcacttattatgag
cgccgtttggtgccagttgagttgcaaccactgggcagtttgttgcgccagaggctggag
caagcgcgtgagctggtactggcgatcaaacaacaaccacatttattgcacgataacccc
gcgttgcagtactccatggacgttagaaacccgtacacagatccgttgcactatctgcaa
agcgagctgttgtaccgtgagcgtcaagctggcgacagcagtcatgagcaagttgagcaa
gctctgaaggtgaccatggcgggcatcgcagcgggaatgcgcaatactggctga

DBGET integrated database retrieval system