KEGG   Bipolaris sorokiniana: COCSADRAFT_36900Help
Entry
COCSADRAFT_36900  CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 2 protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bsc  Bipolaris sorokiniana
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    COCSADRAFT_36900
  Lipid metabolism
   00600 Sphingolipid metabolism
    COCSADRAFT_36900
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    COCSADRAFT_36900
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     COCSADRAFT_36900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 882 aa AA seqDB search
MLSSSGTLYRTYKFVLLGFLFSLCFDATTAHVVKKPRAASAGRVRSSLNAGWRFSRFTSN
PDGLSYETLKPWIMPSANDFIVGDKYQRPSGVAPGSNTSYVQSSFDDATWEAVTLPHDWA
ITGTFDAPGVTGDLGFLPINGIGWYRRSVSIDAEIIDSGKTIFLDVEGAMAYATVWLNGQ
LVGGWPFGYNSFRLDLTPYAKAGANMLAIRLDNKLDSSRWYPGAGIYRDVWLVTVDPVHV
AQWGTYITTPSISEAEATVDIVVEVENKANSSQSVEVVTQIYERDPTSKAAKGNSVATFP
TANTDVAGNSKQTVKGSVSVTNPKLWGPAPTQKPNEYVAVTTVSIDGTEMDTYETVFGIR
SVAYDPNQGLLINGERIYVQGSCNHHDLGSLGAAFNVRAAERQIEILMEMGNNALRTSHN
PPAPGYLDLADRMGLLVMDEIFDTWNYAKVENDFHRIFQEWHEPDLRSFIRRDRNHPSII
SWSVGNELREQSNATGTATVKMLQDIAHEEDPTRKVTIGMNNANASTGVAATIDIIGLNY
QGEGKGVSWRSTFPDFKKAFPKKMIWSTESASTISSRGKYLFPVTSNKSAVIGGGPGEGG
DPVTNHISSYDLYAPEWAASPDKVFQMQDMHPYVAGEFVWTGWDYIGEPTPYANVSRSSY
FGIIDLAGFKKDRFYLYQSRWRSDLPMAHILPHWTWPEDRTGETTPVHVYSSGDAAELFV
NGVSAGRKEKAEYEYRFRWDDIKYSPGNVTVVTYKDGAEWATASQVTAGPAASLNITADR
STITGDGYDLSFISVAVHDSQGTLVPTADHAISFKVTSGPGVIISTDNGDPTDLVPFPEK
TRKAFGGLALAIVRSEAGATGEIVVEATAEGLEGGSVTITAA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgttgagctcatctgggacgctgtacagaacgtacaaattcgtcctcctcggcttcttg
ttttcgctttgtttcgatgcaacaactgcacatgttgtcaagaaaccgcgtgcggcttca
gcgggccgtgtgcgctcgtctctcaacgcaggttggcgcttctcacgtttcacatccaat
cccgatggcctgagctacgagacgctgaagccatggattatgccctctgcaaacgacttc
attgttggagataaataccaacgcccttctggtgttgcgcctggttccaacaccagctat
gtgcagtcgagcttcgacgacgcaacctgggaagcagtcactctaccgcacgactgggcc
attacaggaacattcgacgctcctggtgttactggcgacctaggatttctaccaatcaac
ggaattggatggtaccgacgatcagtttcaattgatgctgagattattgactccggaaag
accattttcttggatgttgaaggggccatggcctacgctacggtgtggttgaatggccag
cttgtgggaggatggccttttggctacaattccttccgtctagaccttacgccctacgcc
aaagctggagcaaatatgcttgctattcgcttggacaacaagctggattcatcacgctgg
taccccggtgctggaatctaccgagatgtttggctggtcaccgttgatcctgtacatgtc
gcgcaatggggaacctacattactactcctagcatttcagaagccgaggcaactgttgat
attgtcgttgaagttgagaacaaggccaatagcagccagagtgtcgaggtggttactcag
atctacgagcgcgaccctacatccaaggcggccaagggcaatagtgttgcgacctttcca
acggcaaataccgatgtggcagggaactcgaagcaaactgtaaaaggttcagtttcagtg
acaaaccctaagctttgggggcctgcaccaactcagaaacccaacgagtatgttgccgtt
accactgtatcaattgacggaacagagatggatacctacgaaactgtctttggtatccgc
tctgtcgcatacgacccaaatcaaggtcttcttatcaacggtgagcgcatctacgtgcaa
gggtcttgcaaccatcacgatcttgggtcgctaggtgctgctttcaacgtacgagctgcg
gagcgccagattgagattctaatggagatgggtaacaatgctctccggacttcgcacaat
ccaccagcacccgggtacctggatctcgctgaccgcatgggcctactggtcatggatgag
atttttgatacctggaattacgcgaaggtagaaaacgactttcatcgcattttccaagaa
tggcatgagccagaccttcgttcatttatccgccgcgatcggaaccatccttccatcatc
tcttggtccgttggcaatgagcttcgggaacaatccaacgctactggcactgcaaccgtc
aagatgcttcaagatatagctcacgaggaagatcctactcgaaaagttaccattggtatg
aacaatgccaatgcaagcactggagttgctgcaaccatcgacattatcggcctaaactac
cagggagaaggtaaaggtgtctcttggcgaagcacatttcctgatttcaagaaagcattt
cccaagaagatgatttggagtaccgagtctgcttctactatcagctctcgtggcaagtac
ctgttccctgtcacttccaacaagagcgcagtaatcggcggagggcctggcgaaggcgga
gatcctgtgacgaaccacatcagctcttacgatctctacgcaccggagtgggctgcatcc
ccggacaaagtcttccaaatgcaagatatgcacccttatgttgcgggagagtttgtctgg
actggatgggattacattggtgagcctacgccatacgccaatgtaagccgcagttcctac
tttggcatcatcgatcttgcagggttcaagaaagaccgcttctatctctaccaatcccgc
tggaggtctgatcttcccatggcacacattctaccccactggacctggccagaggaccgt
actggcgagaccactcctgtgcatgtctacagctctggtgacgcagccgaactcttcgta
aacggtgtttctgctggtcgcaaggaaaaggcagaatacgaataccgcttccgttgggat
gacatcaagtacagccccggcaacgtcaccgtagtaacttacaaggatggcgcagaatgg
gcaaccgcgtcgcaagtcacagcgggacctgctgcctcactcaacatcactgcagaccgc
tctaccatcaccggtgacggctacgacctctctttcatctctgtggctgtacatgatagc
cagggtactctcgttccgacggccgaccacgcaatcagcttcaaggtcacatccggccct
ggtgtcattatcagtacggacaacggcgatccaacagatctggtaccgttcccggagaaa
accaggaaggcttttggcggtttggcgctggctattgtaaggagtgaagctggggcaacc
ggagagattgtggttgaagccacggcggagggcctagaaggcggtagtgtgactattact
gccgcttga

DBGET integrated database retrieval system