KEGG   Bipolaris sorokiniana: COCSADRAFT_96111Help
Entry
COCSADRAFT_96111  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc03030  DNA replication
bsc03410  Base excision repair
bsc03420  Nucleotide excision repair
bsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    COCSADRAFT_96111
   03410 Base excision repair
    COCSADRAFT_96111
   03420 Nucleotide excision repair
    COCSADRAFT_96111
   03430 Mismatch repair
    COCSADRAFT_96111
Enzymes [BR:bsc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     COCSADRAFT_96111
    6.5.1.6  DNA ligase (ATP or NAD+)
     COCSADRAFT_96111
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     COCSADRAFT_96111
DNA replication proteins [BR:bsc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    COCSADRAFT_96111
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     COCSADRAFT_96111
DNA repair and recombination proteins [BR:bsc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     COCSADRAFT_96111
   NER (nucleotide excision repair)
    Other NER factors
     COCSADRAFT_96111
   MMR (mismatch exicision repair)
    Other MMR factors
     COCSADRAFT_96111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 19141661
NCBI-ProteinID: XP_007702956
JGI: Cocsa1_96111
UniProt: M2R3A0
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MAPKQATLGKFFGKPNGDAKQQSKLAFSTKPKPSKKDSTPQEEPQSSPKDLNKEQDEEVG
SDAEVRAPVKEQVESDGEAMEVDSVSSETGKKRQIKEEVEEESEEEPPSKRQRRKPSPKK
AAAKPKTEKASPKSKKSAAKSKAAEPEDEEEEASTKAKGKKGKKEAEKSSALAKEETESS
KEQEEDEVVSSEEEPEEVKVKARKQVQTTLASNTKDPYPDWKPGEPVPYAALCTTFSKIE
MTTKRLEILAHCSLFLRQVLRLTPSDMLPTVMLMVNKLAADYAGIELGIGESLIMKAISE
STGRSLQHIKSDQNEIGDLGLVAAKSRSKQPTMFKPKALTVEGVRKGLMAIATIEGQGAQ
GRKVDGIKKLLSAADAHNSGKNVDIEKDKGGPSEAKFIVRTLEGKLRLGLAERTVVVAVA
QAMIFHEMSLQGKTPSTEDLGKAEAMLKTVYSELPSYEVIIPAMIEHGIMNLRENCRLQP
GVPLKPMLAKPTKSITEVLDRFEGKDFTCEYKYDGERAQIHFVAHDAEIELATEAPSAGK
SERGVSNIFSRNSEDLSKKYPDILAKLPTWVKEGTKSFVLDCETVAWDMVEKKVLPFQQL
MTRKRKDVKVEDVKVKVCVFAFDILYLNGEALVTKSFRERREHLKEAFVPVEGEFAFAKY
GNTNELEEIQTLLEDSVKEGCEGLMVKMLDGPESYYEPSKRSQNWLKVKKDYLAGVGDSL
DLVVLGAYYGKGKRTSWYGAFLLACYNPSTEKYETVCNIGTGFSEAILETLHKTLSEIVI
DRPKPFYTHSTGNKDQPDVWFEPRYVWEVKTADLTLSPRYKAAAAEVGGGGKGVSLRFPR
FIKEREDKKPDQASSSRMIAEMYQRQESVAKNKGPSVDDDFEY
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaagcaagctacacttggcaagttctttgggaaacccaacggcgatgcaaag
cagcaatcgaaactagccttttctacgaaaccgaagccaagcaagaaagattcaacacca
caggaagagccacaatcctcaccaaaggacctgaataaggaacaagatgaggaggtcggc
tcggacgcagaggttagagcaccggtcaaggagcaagtagagtcagatggcgaggcaatg
gaggtggatagcgtaagctctgagactggcaagaagaggcaaatcaaagaagaggtagaa
gaggagtctgaggaagaacctccaagcaaacgtcaacggagaaaaccttcgccgaagaag
gcagccgcgaaaccaaagactgaaaaggcatcgcccaagtcaaagaaatctgctgctaaa
tccaaggctgcagagccagaagacgaggaagaggaagcgtcgacgaaggccaagggaaag
aagggcaagaaggaggctgaaaagtcttctgcactagcaaaggaggaaaccgaatcgagc
aaggagcaagaagaggatgaggtggtcagctctgaagaggagcctgaagaggtcaaggtc
aaggcgcgaaagcaggtacagacaacccttgcgtccaacaccaaggacccatatcccgat
tggaaaccaggcgagccagttccatatgcggcactatgcacaacgttttcgaagattgag
atgacgacgaagcgcttggagattcttgcacactgctcgttgtttttaagacaggttttg
cgattgactccatccgatatgctgccaactgtcatgctcatggttaacaagcttgcagct
gattatgcaggcattgagcttggtattggcgagtcgctaatcatgaaggcaatttccgag
agtactggacgaagcttacaacacatcaagagcgatcagaacgaaatcggagatcttggc
cttgttgcagcaaagagtcgatcaaaacagcctaccatgttcaagcccaaggcgttgaca
gtcgagggtgtgcgcaagggacttatggccatcgctactatcgaaggacaaggtgctcag
gggcgcaaggttgatgggatcaagaagctgctgtcagcggcagatgcgcacaactctggc
aagaacgttgatattgagaaggacaaaggtggacccagtgaagccaagttcatcgtgcga
acactcgagggtaaacttcgactaggccttgctgagaggactgttgttgtagctgtcgca
caggcaatgatcttccatgaaatgtcacttcagggcaagacgccatcgacagaggatctg
ggcaaagcagaagctatgctaaagacggtttacagcgagctaccgagttacgaagtcatc
atcccagcaatgattgaacacggcatcatgaacctgcgcgagaactgtcgcctacagccc
ggtgtacccctgaagcctatgcttgccaagccaacgaagtccatcacggaggtgttagat
cgctttgagggcaaggactttacttgcgaatacaagtacgatggagagcgcgcacagatc
cactttgtcgctcacgatgcagagatagagctggctactgaagcacccagcgctggcaag
agcgagcgtggcgtgtccaacatcttctcgcgcaactctgaggatctgtctaagaaatat
cctgatattctcgccaagctgccaacttgggtcaaagaaggcacaaagagcttcgttctt
gactgcgagacggttgcctgggatatggtagagaagaaggtgctgccttttcaacagctc
atgacgaggaagaggaaggatgtcaaggtcgaagacgtcaaggtcaaggtttgcgttttt
gcctttgatatcctctatctcaatggcgaggcactagtaacgaagtcattccgtgagcgt
cgcgagcatctcaaagaagccttcgtaccggtcgaaggcgagtttgcatttgccaagtat
ggcaatacgaacgaactagaggagattcaaacactcctcgaagactcggtcaaggaaggc
tgcgaaggcctcatggtcaagatgttggacggtccagaatcttactacgagccatccaag
cgctcgcagaattggctcaaggtcaagaaggactaccttgccggtgtcggtgattcactg
gatctcgtggtgctgggagcctactacggcaaaggcaagcgtaccagctggtatggtgcc
tttttgcttgcctgctacaatccttcgacggaaaagtatgaaacagtctgtaacattggt
actggtttctctgaagccatcctggaaactctgcacaagacactttctgagattgtcatc
gaccgaccaaagccattctacacacattcgactggcaacaaagaccagcctgacgtatgg
ttcgagccgcggtacgtgtgggaggtcaagactgcggatctcaccttgtcgccacggtac
aaggcagctgcagctgaagttggcggtggtggcaagggtgtcagtttacgcttcccacga
ttcatcaaggagagggaggacaagaagccggatcaggcgagttcaagtcgtatgattgcg
gaaatgtaccaaaggcaagaaagtgtggccaagaacaagggacctagtgttgatgacgac
tttgagtattga

DBGET integrated database retrieval system