KEGG   Bifidobacterium scardovii: BBSC_2316Help
Entry
BBSC_2316         CDS       T03975                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bsca  Bifidobacterium scardovii
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BBSC_2316
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBSC_2316
Enzymes [BR:bsca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BBSC_2316
Bacterial toxins [BR:bsca02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BBSC_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2802778..2805060)
Genome map
AA seq 760 aa AA seqDB search
MTHLSHHIDRAWSTASLPESGGTLRATFRISSDGALLEAKAAERLVLGVSVACGSLRIEA
PEEGIVLDVEDTYGVQLGGVHDLHVTFGDFGTRIYVDGYQAFACATNICPSKYARKGMFV
CADEPGMRVERVECFAQAWTSERIQRNVPIPQPDIEFAAAYVAGKDIVALRAMKTGTVHA
QFRVRGLGQFGTIVAARTAEGQVLDVSIDDDGFVYRVLANGEWCEYRAFGSWNDGGWHDL
VVRAFRGAIDIYVDGNMEIHQPGQVFFADYPDLRHVSIGEDSFGVRLCGEVRSGGIYAYP
LMDGQIRKLSDVPPTTDTALFDKGYEGSASYRIPSLAVTPSGVTIAGADRRVVISNDAPN
EIHFVIRRSLDGGQTWLPLQTVIAFPGSGLDGACVIDSCMVCDRETGRVSVLVDHFPGGR
GFANVQRGIGLDEQGRLILHDSKGLEYLLRSDGIVTSRDGDATSYRVDDDGNVTCGGAPA
GNIYLKEGADPCESLLTARTSYVVEVHSDDDGETWSNPRHINHMIKEPWMGFLGTSPGNG
IQLSEGEHRGRLLVPYYCTGTSPKFNAGGALISDDGGRTWRRGKAINEGRTVNGEVVDEQ
DVHDDDATTHESVFVERSDGDVLCLFRNQHHLGRVGKAVSHDGGETWDTVEFDPMLPDIF
SQPNAVTVPAGERGCASDRIIFANASLMRPYRGCGVLRLSEDGGRTWKRNRCFNPYHYVY
QCMSVLPDGAIGLLWERETAGVYFTRLPLSWFGVEALESK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgacacatctctcccatcatatcgatcgggcgtggagtaccgcgtcgcttccggaatcg
ggaggaacgttgcgtgcgacgttccggatttcttcggacggcgccctgctggaggccaaa
gccgcggagcgtctcgtgctcggcgtttccgtcgcgtgcggctcgctgcggatcgaagcc
cccgaggaaggcatcgtgctggacgtcgaggacacctatggcgtgcaacttggcggcgtt
catgatctgcacgtcacattcggtgatttcggcaccagaatctacgtggacggatatcag
gcgttcgcctgcgcgaccaatatctgcccgtcgaaatacgcgcggaaaggcatgttcgtc
tgtgcggatgaaccaggcatgcgcgtcgaacgtgtggaatgctttgcgcaggcgtggact
tcggaacgcatccagcgcaatgtgccgattccgcagcccgatatcgagttcgcggcggcc
tatgtggccgggaaagacatcgttgcattacgcgcgatgaagaccggtacggttcatgcc
cagttccgggtgcgtgggcttgggcagttcgggacgattgtcgcggcaaggaccgccgaa
gggcaggttttggacgtttccattgacgatgatggattcgtttaccgggtgctggccaat
ggcgagtggtgtgagtaccgtgcgttcggatcttggaatgacggcggttggcatgatctg
gtcgtgcgcgcgttccgaggcgccattgacatctatgttgatggaaatatggaaatccac
cagccgggacaggtgttttttgccgattacccggatctgcggcatgtgtcgattggcgag
gactcctttggggtgcgtttgtgcggtgaagtgcggagcggcggcatctacgcgtatccg
ctcatggacgggcagattcgaaagctttcggatgttcctccgacgaccgacacggcgttg
ttcgataaggggtatgaaggttcggcaagctatcgcattccttcgttggccgttactccg
tccggcgtgacgattgcgggcgccgatcggcgtgtggtcatctccaacgacgcgcccaat
gagatccatttcgttatccggcgatccttggacggcgggcagacatggctgcctctgcag
accgttatcgcttttcccggcagcggactggatggcgcgtgcgtcattgattcctgcatg
gtctgtgaccgcgaaaccggccgggtatcggtacttgtcgaccatttcccgggaggaagg
gggtttgcgaatgtacagagaggaatcggcttggacgagcagggacgcctgatcctgcat
gattcgaaaggcctggagtacctcctgcggtccgacggtatcgtgacgtccagagacggt
gacgccacatcgtatcgggtggacgacgatggcaatgtgacgtgcggcggcgctcctgca
ggcaacatctatctcaaggaaggcgccgatccatgcgagagcctgctgaccgcgcgcacc
agctatgtggtggaggtgcattcggacgatgatggcgagacatggtccaatccgaggcat
atcaatcacatgataaaagagccgtggatgggatttctgggcacgtcgcccggtaacggc
atccagctcagcgagggagaacaccgggggcggctgcttgtcccgtattactgcaccgga
acgagtcccaagttcaatgccggtggcgcgctgatctccgatgatggcggccggacatgg
agacgcggcaaggccatcaacgaaggtcggacggtcaacggcgaagtcgtcgatgaacag
gatgtgcatgacgacgatgcgaccacgcatgaatcggtgttcgtggaacggtcggacggg
gacgtgctgtgcctgttccgcaaccaacaccatctgggcagagtgggcaaagcggtcagc
catgatggaggcgaaacatgggatacggtggagtttgacccgatgctgccggacatattc
agccagcccaatgcggtgacggtgccggctggggaacgcggatgcgcctcggaccggatc
atttttgccaacgccagcctgatgcggccgtaccgtggatgcggtgtgctgcgtttgagt
gaggacgggggcagaacctggaagcgcaatcgctgcttcaatccctaccattatgtctat
cagtgcatgtcggtcctgccggatggcgcgatcgggctgttgtgggaacgtgagacggct
ggtgtgtactttacgcgtctgccgttgagctggttcggcgtggaggcgctggaatccaaa
tag

DBGET integrated database retrieval system