KEGG   Brucella suis bv. 1: BSS2_I0196Help
Entry
BSS2_I0196        CDS       T03181                                 

Gene name
glpD
Definition
(GenBank) glpD
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsf  Brucella suis bv. 1
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSS2_I0196 (glpD)
Enzymes [BR:bsf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSS2_I0196 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:210775..212286
Genome map
AA seq 503 aa AA seqDB search
MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVCEALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGLFLYDHLGGRKK
LPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADRGAKIATRTSVV
AASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQGVEGDRQLHNIRLVQGSH
IVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAITDSETDYLC
QAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARKLAEHMLQKIEHRLGRKGAPWTHVAPLPGGDFEDVAFETELKKLEAAYPFLDAR
HARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAEDILWRRTK
LGLRLTAAEVAAVQGFVEPAIAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaaaacaattcgatatttttattataggtggcggcatcaatggctgcggc
attgcccgtgatgcggtggggcggggcttcaccgttgggctggccgagatgaacgatctg
gcaagcggcacctcttcgcgcgcaaccaagctcattcacggtggtttgcgctatctggaa
cattatgaattccggctggtgtgcgaggcgctgatggagcgcgaggtgctgtgggccaat
gcgccgcatatcatccatccgatgcgtttcgtgctgccttatcataagggcggcctacgt
cccgcctggctgttgcggcttggcctgtttctttacgaccatctgggcggccgcaagaag
cttcccgccacgcgcacgctcaacatgcgcaccgacaaggccggcgaaccgctgaaaccg
cttttcaccaaggcttttgaatattccgattgctgggtggacgatgcgcgcttcgtggcg
ctcaccgcccgcgatgcggctgatcgcggcgcgaagatcgcgacccgaacgagcgtcgtt
gccgcaagccgcgacgggcagggctggaccatcacactggaagataccggcaccggcagg
cgtgagaacgtacacgcccgccttctggtcaatgccgccgggccgtgggccgacaaggtt
ctgcaaggtgtggaaggcgaccggcaattgcacaatatccgtctggtgcagggcagccat
atcgtcgtgcgcaggaagttttccgacccgcgcgcctatttcttccagaacaacgacggg
cgcatcatcttcgccattccttatgaagatgatttcaccctgattggcaccacggatcag
gattataagggcgacccggccaaggtggcgatcaccgacagcgagaccgattatctctgc
caggcggcaagcgaatatttccgcgagccggtgcgccgggaggatatcgtctggacctat
tccggcgtgcgcccgctctatgatgacggggccagcaaggcgcaggaggcaacccgcgac
tatgtgctgaaggaagatgcgccagatggtctggcgccgctcatcaatgttttcggcggc
aagctcaccacagcacgcaagcttgccgaacatatgctgcagaaaatcgagcaccggctt
ggccgcaagggcgccccatggacccatgtagcaccattgccaggcggggatttcgaggat
gtggcttttgaaacggaactgaagaagcttgaggcagcctatcctttccttgatgcgcgc
catgcgcgccgcctgttccggctctatggcacccgggcatataagcttttggggcaggct
tcttcgctgggcgatcttggccgtcattttggcagcgatctctatgaggcggaagtgcgc
tatcttgtcgaaaatgaatgggcgcgaagcgcggaagacattttgtggcggcgcaccaag
ctcggcctgcgcctgacggcggcggaagtcgcggccgtgcagggctttgtggagcctgca
atcgccgcctaa

DBGET integrated database retrieval system