KEGG   Brucella suis bv. 1: BSS2_I0550Help
Entry
BSS2_I0550        CDS       T03181                                 

Definition
(GenBank) Fe/Mn family superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsf  Brucella suis bv. 1
Brite
Enzymes [BR:bsf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSS2_I0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:561015..561614
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLAGKSLEEIVKES
FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA
GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLVNWDYVLEMYEKAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgcccgcccttccgtatgactatgatgcgcttgcgcctttcatgtcg
cgcgaaacgcttgaatatcatcacgacaagcatcatcaggcctatgtcaccaacggtaac
aagcttctcgaaggttccggcctggcaggcaagagcctcgaagaaatcgtcaaggaaagc
ttcggcaagaatcaggccctcttcaacaatgccggccagcactacaaccatatccatttc
tggaaatggatgaagaaggatggcggcggcaagaaactgccgggcaagctggaaaaggcc
tttgattccgatcttggcggttatgacaagttccgcgctgatttcatcgctgccggtgcc
ggccagttcggttcgggctgggcctggctttccgtcaaggacggcaagcttgaaatttcc
aagaccccgaacggtgaaaacccgctcgtgcacggtgcggcgccgatcctcggcgtggat
gtgtgggaacactcctattacatcgattaccgcaacgcgcgtccgaaatatctcgaagct
ttcgtcgatagcctcgtgaactgggattacgtgctggaaatgtacgaaaaggcggcataa

DBGET integrated database retrieval system