KEGG   Brucella suis bv. 1: BSS2_I1048Help
Entry
BSS2_I1048        CDS       T03181                                 

Gene name
hisI
Definition
(GenBank) hisI
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bsf  Brucella suis bv. 1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BSS2_I1048 (hisI)
Enzymes [BR:bsf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSS2_I1048 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:1046277..1046696
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QVVSSGGKVALTMVSDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggtaagcgatcacgatcaataa

DBGET integrated database retrieval system