KEGG   Brucella suis ZW046: IY72_00840Help
Entry
IY72_00840        CDS       T03427                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsg  Brucella suis ZW046
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    IY72_00840
Enzymes [BR:bsg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IY72_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:184292..185803
Genome map
AA seq 503 aa AA seqDB search
MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVCEALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGLFLYDHLGGRKK
LPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADRGAKIATRTSVV
AASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQGVEGDRQLHNIRLVQGSH
IVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAITDSETDYLC
QAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARKLAEHMLQKIEHRLGRKGAPWTHVAPLPGGDFEDVAFETELKKLEAAYPFLDAR
HARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAEDILWRRTK
LGLRLTAAEVAAVQGFVEPAIAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaaaacaattcgatatttttattataggtggcggcatcaatggctgcggc
attgcccgtgatgcggtggggcggggcttcaccgttgggctggccgagatgaacgatctg
gcaagcggcacctcttcgcgcgcaaccaagctcattcacggtggtttgcgctatctggaa
cattatgaattccggctggtgtgcgaggcgctgatggagcgcgaggtgctgtgggccaat
gcgccgcatatcatccatccgatgcgtttcgtgctgccttatcataagggcggcctacgt
cccgcctggctgttgcggcttggcctgtttctttacgaccatctgggcggccgcaagaag
cttcccgccacgcgcacgctcaacatgcgcaccgacaaggccggcgaaccgctgaaaccg
cttttcaccaaggcttttgaatattccgattgctgggtggacgatgcgcgcttcgtggcg
ctcaccgcccgcgatgcggctgatcgcggcgcgaagatcgcgacccgaacgagcgtcgtt
gccgcaagccgcgacgggcagggctggaccatcacactggaagataccggcaccggcagg
cgtgagaacgtacacgcccgccttctggtcaatgccgccgggccgtgggccgacaaggtt
ctgcaaggtgtggaaggcgaccggcaattgcacaatatccgtctggtgcagggcagccat
atcgtcgtgcgcaggaagttttccgacccgcgcgcctatttcttccagaacaacgacggg
cgcatcatcttcgccattccttatgaagatgatttcaccctgattggcaccacggatcag
gattataagggcgacccggccaaggtggcgatcaccgacagcgagaccgattatctctgc
caggcggcaagcgaatatttccgcgagccggtgcgccgggaggatatcgtctggacctat
tccggcgtgcgcccgctctatgatgacggggccagcaaggcgcaggaggcaacccgcgac
tatgtgctgaaggaagatgcgccagatggtctggcgccgctcatcaatgttttcggcggc
aagctcaccacagcacgcaagcttgccgaacatatgctgcagaaaatcgagcaccggctt
ggccgcaagggcgccccatggacccatgtagcaccattgccaggcggggatttcgaggat
gtggcttttgaaacggaactgaagaagcttgaggcagcctatcctttccttgatgcgcgc
catgcgcgccgcctgttccggctctatggcacccgggcatataagcttttggggcaggct
tcttcgctgggcgatcttggccgtcattttggcagcgatctctatgaggcggaagtgcgc
tatcttgtcgaaaatgaatgggcgcgaagcgcggaagacattttgtggcggcgcaccaag
ctcggcctgcgcctgacggcggcggaagtcgcggccgtgcagggctttgtggagcctgca
atcgccgcctaa

DBGET integrated database retrieval system