KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_03040Help
Entry
BSU6051_03040     CDS       T02503                                 

Gene name
amyE
Definition
(GenBank) alpha-amylase AmyE
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU6051_03040 (amyE)
Enzymes [BR:bsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BSU6051_03040 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
327617..329596
Genome map
AA seq 659 aa AA seqDB search
MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAPSIKSGTILHAWNWSF
NTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQPTSYQIGNRYLGTEQE
FKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHIELPDDGSYGSQFWPNITN
TSAEFQYGEILQDSASRDAAYANYMDVTASNYGHSIRSALKNRNLGVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGNNQIFMNQRGSHGVVLANAGSS
SVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINARSVAVLYPDDIAKAPHVFLENYK
TGVTHSFNDQLTITLRADANTTKAVYQINNGPETAFKDGDQFTIGKGDPFGKTYTIMLKG
TNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQVNAYIYKHDGSRVIELTGSWPGKPM
TKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQNQPGFDYVLNGLYNDSGLSGSLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaaacgattcaaaacctctttactgccgttattcgctggatttttattgctg
tttcatttggttctggcaggaccggcggctgcgagtgctgaaacggcgaacaaatcgaat
gagcttacagcaccgtcgatcaaaagcggaaccattcttcatgcatggaattggtcgttc
aatacgttaaaacacaatatgaaggatattcatgatgcaggatatacagccattcagaca
tctccgattaaccaagtaaaggaagggaatcaaggagataaaagcatgtcgaactggtac
tggctgtatcagccgacatcgtatcaaattggcaaccgttacttaggtactgaacaagaa
tttaaagaaatgtgtgcagccgctgaagaatatggcataaaggtcattgttgacgcggtc
atcaatcataccaccagtgattatgccgcgatttccaatgaggttaagagtattccaaac
tggacacatggaaacacacaaattaaaaactggtctgatcgatgggatgtcacgcagaat
tcattgctcgggctgtatgactggaatacacaaaatacacaagtacagtcctatctgaaa
cggttcttagacagggcattgaatgacggggcagacggttttcgatttgatgccgccaaa
catatagagcttccagatgatggcagttacggcagtcaattttggccgaatatcacaaat
acatctgcagagttccaatacggagaaatcctgcaggatagtgcctccagagatgctgca
tatgcgaattatatggatgtgacagcgtctaactatgggcattccataaggtccgcttta
aagaatcgtaatctgggcgtgtcgaatatctcccactatgcatctgatgtgtctgcggac
aagctagtgacatgggtagagtcgcatgatacgtatgccaatgatgatgaagagtcgaca
tggatgagcgatgatgatatccgtttaggctgggcggtgatagcttctcgttcaggcagt
acgcctcttttcttttccagacctgagggaggcggaaatggtgtgaggttcccggggaaa
agccaaataggcgatcgcgggagtgctttatttgaagatcaggctatcactgcggtcaat
agatttcacaatgtgatggctggacagcctgaggaactctcgaacccgaatggaaacaac
cagatatttatgaatcagcgcggctcacatggcgttgtgctggcaaatgcaggttcatcc
tctgtctctatcaatacggcaacaaaattgcctgatggcaggtatgacaataaagctgga
gcgggttcatttcaagtgaacgatggtaaactgacaggcacgatcaatgccaggtctgta
gctgtgctttatcctgatgatattgcaaaagcgcctcatgttttccttgagaattacaaa
acaggtgtaacacattctttcaatgatcaactgacgattaccttgcgtgcagatgcgaat
acaacaaaagccgtttatcaaatcaataatggaccagagacggcgtttaaggatggagat
caattcacaatcggaaaaggagatccatttggcaaaacatacaccatcatgttaaaagga
acgaacagtgatggtgtaacgaggaccgagaaatacagttttgttaaaagagatccagcg
tcggccaaaaccatcggctatcaaaatccgaatcattggagccaggtaaatgcttatatc
tataaacatgatgggagccgagtaattgaattgaccggatcttggcctggaaaaccaatg
actaaaaatgcagacggaatttacacgctgacgctgcctgcggacacggatacaaccaac
gcaaaagtgatttttaataatggcagcgcccaagtgcccggtcagaatcagcctggcttt
gattacgtgctaaatggtttatataatgactcgggcttaagcggttctcttccccattga

DBGET integrated database retrieval system