KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_29560Help
Entry
BSU6051_29560     CDS       T02503                                 

Gene name
ytcI
Definition
(GenBank) putative acyl-coenzyme A synthetase YtcI
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU6051_29560 (ytcI)
   00620 Pyruvate metabolism
    BSU6051_29560 (ytcI)
   00640 Propanoate metabolism
    BSU6051_29560 (ytcI)
  Energy metabolism
   00680 Methane metabolism
    BSU6051_29560 (ytcI)
Enzymes [BR:bsh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSU6051_29560 (ytcI)
Lipid biosynthesis proteins [BR:bsh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSU6051_29560 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3023659..3025248)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPVQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLKRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctgtgcaatataatttagtgaatgaaatggaa
aagttcagtgctgctggacaaaaaaccgctcttctttgggaggacgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggccttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgctgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctccgaaatg
cttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgctatcgtc
tactccgaatttattggcgctttccgggatgtcagtacggctgacaaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccggg
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgacatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaatcgctac
aaaatcaatgttttctgctgcactccgacagaataccgcttaatggcgaaggttgaaggc
ttgaaacgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaacagaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccgggaagc
atgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcaagccctgatgaaatcagaggctccatcgta
aaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system