KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_0724Help
Entry
A7A1_0724         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YtcI
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7A1_0724
   00620 Pyruvate metabolism
    A7A1_0724
   00640 Propanoate metabolism
    A7A1_0724
  Energy metabolism
   00680 Methane metabolism
    A7A1_0724
Enzymes [BR:bsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     A7A1_0724
Lipid biosynthesis proteins [BR:bsl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   A7A1_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1201576..1203171
Genome map
AA seq 531 aa AA seqDB search
MFVLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQVSWSYEKLMEETNKIGAA
LADLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGA
IVYSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYT
SGTTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSG
ATGFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEP
LNREVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGE
ICKTGEVGDIAVHLSTPAIFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRND
DIIISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVK
MLQNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgtgttaaaacgtgaagatttaattgcccctatgcaatataatttagtgaatgaa
atggaaaagttcagtgccgctggacaaaaaaccgctcttctgtgggaggacgagtcgggt
aagcaagtatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggcc
ttagctgatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgctt
gaagcctatgccgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctcc
gaaatgcttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgcc
atcgtctactcagaatttattggcgctttccgggatgtcagtacggctgacaaactgatt
acactgtctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggac
ggaagccaatttaaaacagctgacacaacaagagatgatatggctttcttatcttataca
tccgggacaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcat
ttaaaaacttctgccggcgcttggcttgatatttctgaaaaggatatcgtctgggcaact
gctgcccctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcgga
gcaaccggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaat
cgctacaaaatcaatgttttctgctgtacgccgacagaataccgcttaatggcgaaggtc
gagggcttggaccgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccg
ctcaaccgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacgga
tatggccaaactgaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccg
ggaagcatgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaa
atctgcaaaactggtgaggttggcgatatcgctgttcacctcagtacgcctgcgatcttt
aaagagtattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttccta
acgggagacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgac
gatattattatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgtt
aagcacccagaagtaaaagaatgtgctgttgtcgcgagccctgatgaaatcagaggctcc
atcgtaaaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaa
atgctgcaaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaa
tttgtggaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaa
cgtgaagaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system