KEGG   Bacillus smithii: BSM4216_0631Help
Entry
BSM4216_0631      CDS       T03984                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bsm  Bacillus smithii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSM4216_0631
  Lipid metabolism
   00071 Fatty acid degradation
    BSM4216_0631
  Amino acid metabolism
   00350 Tyrosine metabolism
    BSM4216_0631
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSM4216_0631
   00626 Naphthalene degradation
    BSM4216_0631
Enzymes [BR:bsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSM4216_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:558459..559481
Genome map
AA seq 340 aa AA seqDB search
MKAAVVNSFKQKLEIKDVEKPTLEYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEVGEGVRSIKVGDRVGIPWLYSACGECEYCLTGQETLCPHQLNGGYSVDGGY
AEYCKAPADYVAKIPEHLDPVEVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVVAVDISDEKSALAKKLGADIAINGLKEDPVETIREKLGGVHAAVSVAVN
RKAFEQAYQSVKRGGTLVVVGLPNDELPIPIFDTVLNGVTVRGSIVGTRKDMQEALDFAA
RGKVRPIVETAPLEDINEVFEKMEKGQINGRIVLKIGEAN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctgttgttaattcatttaaacaaaaattggaaattaaagatgtggagaaa
ccaacattagagtatggggaagtgcttgtgaaaattgaagcgtgcggtgtatgtcatacg
gatcttcatgcggctcacggagactggccggtaaagccgaagcttcctttgataccgggg
catgaaggagtagggattgtggtagaagtcggtgaaggagttcgatcgatcaaagtggga
gatcgcgtcggcattccttggctttattctgcatgtggggaatgtgaatattgtttaacc
ggacaagaaactctgtgtcctcatcaattgaacggcggatattctgtagacggtggttat
gcagagtattgtaaagctcctgctgactacgtggcgaaaattccggaacatttggatcct
gtggaagtggcgccgattttatgtgcgggagtgacgacgtataaagcgttaaaggtttcc
aacgcgaaaccaggggaatgggttgcgatatacggcatcggaggattaggccacattgcg
ctgcaatatgccaaagcgatgggattgaatgttgtagctgtggatattagcgatgaaaaa
tcggcattggctaaaaagttaggggccgatattgcgatcaatggattaaaagaagatccg
gtcgaaacgattcgggaaaaattaggcggagtgcatgcggccgtcagcgtggcagtcaac
cgaaaagcgtttgaacaagcttaccaatccgtaaaacgaggcggtactctcgtcgtcgtt
ggattgccaaatgatgaattgccgattccgatttttgatactgttttaaacggagtaacg
gtaagaggttcgattgtcggaacaagaaaagatatgcaagaagctttagatttcgctgca
cgcggaaaagttcgccccattgtcgaaacggcaccgttagaggatattaatgaagtattt
gagaaaatggaaaaagggcaaattaacggacggatcgtattaaaaattggggaagccaac
taa

DBGET integrated database retrieval system