KEGG   Bacillus subtilis BSn5: BSn5_15585Help
Entry
BSn5_15585        CDS       T01417                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K21802  
vanillin dehydrogenase [EC:1.2.1.67]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSn5_15585
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BSn5_15585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3025853..3027310
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKK
WDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFP
IRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcaggagggcagc
agcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcacaacattccgt
aaagcgactgctgacgatgtagatgaagcgtatcgggcagcggcgctggcaaagaaaaaa
tgggatgcggtcaacccgttcgagaaaagaaccattttagaaaaagccgtcacgtatatt
gaagaaaatgaagaagccattatttatttgattatggaggagctaggcggtacaaggctc
aaagcagcttttgaaatcggtcttgtcaaaaacatcataaaagaagcggcaacgttccca
atccgcatggaggggaaaattcttccgtcaacaatagatggcaaggaaaacagattatat
cgcgtgccggcaggcgttgtcggtgtcatcagtccgtttaacttcccattctttttatct
atgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaagccgcatgag
gaaacgccgatttgcggcggaacgctgattgcgaaaatttttgagaacgcgggaattcca
gcggggctgctgaatgttgttgtcacagacattgctgaaatcggcgacagcttcgttgag
catccagtgccgcggatcatctcatttaccggttctacgaaagtcggcagctacatcgga
cagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcgggaacagcgccttc
atcgtacttgaggatgcagatatagaatatgcggtcaatgcggcggtgttcagccgattt
acacatcaagggcagatttgcatgtcagccaaccgcgtgcttgttcattcttctatttat
gacaagttccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggcgacccaatg
gaccctgatacgattatcgggccattaatcaacagcagacagacggacgggctgatgaag
actgtagagcaagcaattgaagaaggcgctgtaccagtgaagcttggcggatttaacggg
acgatcgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcattgccaaggaa
gagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgaagcggtggat
atcgcaaacgaaaccccgtttggcttgagcggtgccgtacatacgtcaaatcttgagcgc
ggcgtggcttttgcgaaacgcattgaaacaggcatgattcacgtcaatgacacgaccatc
aatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggccgtttaaac
ggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccagcacgaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system