KEGG   Bacillus subtilis QB928: B657_07350Help
Entry
B657_07350        CDS       T02292                                 

Gene name
yfmT
Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00627  Aminobenzoate degradation
bsq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B657_07350 (yfmT)
Enzymes [BR:bsq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     B657_07350 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFQ56656
LinkDB All DBs
Position
786591..788048
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKK
WDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFP
IRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcaggagggcagc
agcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcacaacattccgt
aaagcgactgctgacgatgtagatgaagcgtatcgggcagcggcgctggcaaagaaaaaa
tgggatgcggtcaacccgttcgagaaaagaaccattttagaaaaagccgtcacgtatatt
gaagaaaatgaagaagccattatttatttgattatggaggagctaggcggtacaaggctc
aaagcagcttttgaaatcggtcttgtcaaaaacatcataaaagaagcggcaacgttccca
atccgcatggaggggaaaattcttccgtcaacaatagatggcaaggaaaacagattatat
cgcgtgccggcaggcgttgtcggtgtcatcagtccgtttaacttcccattctttttatct
atgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaagccgcatgag
gaaacgccgatttgcggcggaacgctgattgcgaaaatttttgagaacgcgggaattcca
gcggggctgctgaatgttgttgtcacagacattgctgaaatcggcgacagcttcgttgag
catccagtgccgcggatcatctcatttaccggttctacgaaagtcggcagctacatcgga
cagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcgggaacagcgccttc
atcgtacttgaggatgcagatatagaatatgcggtcaatgcggcggtgttcagccgattt
acacatcaagggcagatttgcatgtcagccaaccgcgtgcttgttcattcttctatttat
gacaagttccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggcgacccaatg
gaccctgatacgattatcgggccattaatcaacagcagacagacggacgggctgatgaag
actgtagagcaagcaattgaagaaggcgctgtaccagtgaagcttggcggatttaacggg
acgatcgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcattgccaaggaa
gagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgaagcggtggat
atcgcaaacgaaaccccgtttggcttgagcggtgccgtacatacgtcaaatcttgagcgc
ggcgtggcttttgcgaaacgcattgaaacaggcatgattcacgtcaatgacacgaccatc
aatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggccgtttaaac
ggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccagcacgaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system