KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2178Help
Entry
I33_2178          CDS       T01837                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Brite
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I33_2178 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2095004..2095594)
Genome map
AA seq 196 aa AA seqDB search
MHRLLLLMMLTALGVAGCGQKKTPDPPNRVPEKKVVETSAFGHHVQLVNREGKAVGFIEI
KESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGH
HAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNS
GARIVCGALLGNNEKQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtctcttgctgttgatgatgctgacggcactgggagttgccggatgcggacaa
aaaaaaactccagaccctcctaaccgggtgccggaaaaaaaagtggttgaaacgtcagcg
tttggtcatcatgtccaactggtcaatcgtgaagggaaagcagtcggttttatagagatc
aaagaatcagatgatgaaggcctcgatattcatatttccgcaaacagcctgcgtccaggt
gcttctctcggttttcatatttatgagaaaggctcttgtgtcaggccggattttgaatca
gcgggcggtccctttaatccactgaacaaagaacacggcttcaacaatccgatggggcat
catgccggagatctgccgaaccttgaagtcggtgctgatggaaaggtagatgtcattatg
aatgcgcctgacacttcactgaaaaaaggaagtaaactaaatattctcgacgaggacgga
agtgcatttattattcatgaacaagccgatgattatctgacaaacccaagcggcaattcc
ggtgcgcgtattgtctgcggagcccttttgggaaataacgagaagcagtaa

DBGET integrated database retrieval system