KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_01265Help
Entry
BSUW23_01265      CDS       T01302                                 

Gene name
ycbD
Definition
(GenBank) 2,5-dioxovalerate dehydrogenase (alpha-ketoglutaric semialdehyde dehydrogenase)
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSUW23_01265 (ycbD)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BSUW23_01265 (ycbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
257134..258600
Genome map
AA seq 488 aa AA seqDB search
MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNSTADDVERAVAAANKA
KTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPEAKGETARGIAILRYYA
GEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKVAPALVYGNTVVIK
PATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHEGVDAVTFTGSNQVGKI
IGQTALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKCTATSRVIVQSG
VYGRFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQEGASLLIGGEK
LEDGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALIKVDSMKDALDIANDVKFGLSA
SIFTQNIGLMLSFIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGEAAKDFFTA
IKTVFVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatcacggaacaaaacacgtatctcaactttattaacggagagtgggttaag
tctcaatcaggtgatatggtcaaggtcgaaaaccctgcggacgtgaatgatattgtcggc
tatgtacagaattcaacagctgatgatgtggaacgggcagtcgccgccgccaataaagcc
aaaacggcttggagaaagctgacgggtgccgagcggggccaatacttatacaaaacggcg
gatattatggagcagcgcttggaggaaatcgccgcctgcgcaacgcgtgagatggggaaa
acactgccggaagcgaaaggggaaacagctcgcggaattgcgattctgcgctattacgcc
ggagaaggcatgcgcaaaacgggtgacgtcattccgtcaactgacaaagacgcgctcatg
ttcaccacccgtgttccgctcggtgtggttggcgtgatttctccgtggaacttcccggtg
gcgataccgatttggaaggtggccccggctttggtatacggcaataccgttgtcatcaaa
ccggcgacagaaacagccgttacatgtgcgaaaatcattgcctgctttgaagaagccggg
ctcccggcaggagtcatcaatttggtgacaggcccgggttctgttgtcgggcagggactt
gctgagcatgaaggtgtagacgccgttacgtttactggttcaaatcaagtcgggaaaatc
atcgggcaaaccgctttagcgagaggagccaaatatcagctagaaatgggcggcaaaaac
ccggtcatcgtagccgatgacgctgaccttgaagctgcggcagaagcggtcattacgggt
gccttccgttcaaccggccagaagtgcaccgcgacaagccgcgtcatcgtgcaaagcgga
gtttacggccgttttaaagaaaaactgctccagcgtacaaaggatattacgatcggagac
agcttaaaagaggatgtctggatggggccgattgccagcaagaatcagctggataactgc
ctgtcgtacattgagaaaggcaaacaggagggtgcttcccttttgattggaggagaaaag
ctggaggacggaaagtatcaaaacggctattatgttcagcctgccatttttgacaatgtg
acatctgagatgacgattgcccaagaagaaattttcggtccggtgattgccctgatcaag
gttgactcgatgaaggacgcgctggacatcgccaatgatgtgaagttcggcttaagcgca
tccatttttacgcaaaacatcggcctaatgctttcattcattgatgaaattgacgccggg
cttgtccgaattaacgcagaaagtgcgggtgttgagctccaggcgccttttggcggcatg
aagcagtcgagctcccactcccgtgaacagggtgaggcagcgaaggactttttcacggcg
atcaaaaccgtttttgtgaagccgtaa

DBGET integrated database retrieval system