KEGG   Burkholderia stagnalis: WT74_17330Help
Entry
WT74_17330        CDS       T04885                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bstg  Burkholderia stagnalis
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bstg00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WT74_17330
Enzymes [BR:bstg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WT74_17330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(183206..184111)
Genome map
AA seq 301 aa AA seqDB search
MSRPTKRLANAARLSALREAIDRKQCIRLMESFSPISAMIIESLCLNSGGQALTYDGFWS
SSLTDSTVRGKPDIELLDLRSRLANIGEIFENTNLPLVMDGDTGGQSEHLALNVPLIEAA
GVSALIIEDKVGLKRNSLFGNDVFQEQADIREFSEKLKIAADAKNHRDFMIIARIESLIL
EKGMDDALRRAYAYSEAGADGVMIHSRRASADEVFEFARHYRRNFPTTPLVCVPTSFNSV
RYDDLAAAGFNIVIYANQLLRAAYPAMESVARSILEHGRSLEAEPALLPIKDVLSLIPGA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgacccaccaagcgtctggccaacgccgcacgattgtccgcattacgcgaggcc
atcgatcgcaagcaatgcatccgattgatggagtctttcagtccgatcagtgcaatgatc
atcgagtcgctttgcctgaacagcggcgggcaggcgctgacatacgacggcttctggtcg
agttcgctcaccgactccacggtgcgcggcaaaccggatatcgaattgctcgacttgaga
agccgcctggccaatatcggcgaaatattcgagaacacgaatttgccgctggtaatggat
ggcgatacgggcggtcaatccgagcatctcgcgctcaatgtcccattgattgaagcggcc
ggcgtttcagcgctgattatcgaagacaaggtcgggctcaagcggaattccctgttcggg
aatgacgtatttcaggagcaggccgatattcgcgagttttccgaaaaactgaaaatcgcg
gcggatgcgaaaaaccatcgcgatttcatgattatcgcgagaatcgagagcctgatactg
gaaaagggcatggacgacgcgctgcggcgcgcgtacgcctattcagaggccggcgcggac
ggcgtcatgattcacagccgccgcgcgtccgccgacgaggttttcgagttcgcgcggcac
tatcggcgcaacttcccgaccacgccgctcgtatgcgtgccgacgagcttcaacagcgtg
cgctacgacgatctggccgccgccggtttcaatatcgtgatctacgcgaaccagttgctg
cgcgcggcgtatccggcgatggaaagcgtcgcgcgcagcatcctggagcatggccgctcg
ctcgaggccgagcccgcgctgctgccgatcaaggatgtgctgagcctgattccaggcgca
ggctag

DBGET integrated database retrieval system