KEGG   Burkholderia stagnalis: WT74_26640Help
Entry
WT74_26640        CDS       T04885                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bstg  Burkholderia stagnalis
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bstg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    WT74_26640
Enzymes [BR:bstg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WT74_26640
Transporters [BR:bstg02000]
 Other Transporters
  Pores ion channels [TC:1]
   WT74_26640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1482954..1483679
Genome map
AA seq 241 aa AA seqDB search
MRYELYYWPGIQGRGEFVRLALEAAEADYVDVARRSGRGMGMPAMTRLLDSASETCLPFA
PPFLKAGDQLIGQTANILLFLGSRHGLAPSDEAGRLWVHQLQLTVADFVNEVHDTHHPIA
SSLYYEDQMPEAEARARDFLKHRVPKFLGYFGKVLAHNPHKSGCMAGDTLTYADLSIFQV
IEGLRYAFPNAMARIEPKHPRLTALHDRVAQHPPVARYLASERRIPFNEEGIFRHYAELD
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgagctctactactggcccggcatccagggccgcggcgaattcgtgcggctg
gcgctcgaagcggccgaagccgactacgtggacgtcgcgcgccgctccgggcgcggcatg
ggcatgccggcgatgacgcggctgctggacagtgcgtccgagacctgcctgccgttcgcg
ccgccgttcctcaaggccggcgaccagctgatcggccagaccgccaacatcctgctgttc
ctcggcagccgccacgggctggcgccgagcgacgaagccgggcgcctgtgggtccatcag
ctgcagctgacggtggccgatttcgtcaacgaagtgcatgacacccatcatccgatcgcg
agcagtctgtactacgaggatcagatgccggaggccgaggcgcgggcacgggatttcctg
aagcaccgcgtgccgaagttcctcggctacttcggcaaggtgctcgcgcacaatccgcac
aagagcggctgcatggcgggcgacacgctgacctatgcggacctgtcgatcttccaggtg
atcgaagggctgcgctacgcgttcccgaacgcgatggcccgcatcgaaccgaagcatccg
aggctgaccgcgttgcacgaccgggtggcgcagcatccgccggtcgcacgctacctcgcg
tccgagcggcgcattccgttcaacgaggaagggatcttccggcactacgccgagctcgac
gcatag

DBGET integrated database retrieval system