KEGG   Burkholderia stabilis: BBJ41_33935Help
Entry
BBJ41_33935       CDS       T04946                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
bstl  Burkholderia stabilis
Pathway
Tryptophan metabolism
Metabolic pathways
Module
Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:bstl00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BBJ41_33935
Enzymes [BR:bstl01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BBJ41_33935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(293703..294932)
Genome map
AA seq 409 aa AA seqDB search
MTTREHCAALDAADPLAHCRARFDLPADTIYLDGNSLGAMPANVPARMQRALEHEWAHGL
IRSWNDADWYPAPQRTGDKIAALIGAGKGEVIVADSTSVNLFKVLVAATRMRPGRRVILA
ERTNFPTDVYIAASVAELTGCELRCVDPDEIVAAIDEDVAVVSLTHVNYKSGKRYDMAAV
TRQAHEAGALSVWDLCHSAGAMPIGLNACDADFAVGCGYKYLNGGPGAPAYVFVASRHLA
DVRQPLTGWHGHAKPFDFTHDYAPHPAIDRMLTGTAPQLGVIALEAALDAFDGVDLGVLR
DKSVALGDLFIALVDQELDGLGFTLASPRDAAQRGSQVSLAHAQGYAIVQALIARNMIGD
FRAPDILRFGFAPLYVRYVDVWDTIAALKDVVATGAWNTDAFLARKSVT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgcgaacactgcgccgcgctcgatgcggccgacccgctcgctcactgccgc
gcgcgcttcgacctgcccgcggacacgatttacctcgacggcaactcgctcggcgcgatg
cccgcgaatgtgcccgcgcgcatgcagcgcgcgctcgaacacgaatgggcgcacgggctg
atccgctcgtggaacgacgccgactggtatccggcgccgcagcgcaccggcgacaagatc
gccgcgctgatcggcgcgggcaagggcgaggtgatcgtcgccgattcgacgtcggtgaac
ctgttcaaggtgctcgtcgcggccacgcggatgcggccggggcgccgcgtgatcctggcc
gagcgcaccaatttcccgaccgacgtgtatatcgcggcgagcgtcgccgagctgaccggc
tgcgagctgcgttgcgtcgatcccgacgagatcgtcgcggcgatcgatgaggacgtggcc
gtcgtgtcgctcacgcacgtgaactacaagagcggcaagcgctacgacatggcggccgtc
acgcgccaggcgcacgaagccggcgcgctgagcgtatgggatctgtgtcactccgccggc
gcgatgccgatcgggctgaacgcatgcgatgcggatttcgcggtcggttgcggctacaag
tacctgaacggcgggcccggcgcgccggcctacgtgttcgtcgcgtcgcggcatctcgcc
gatgtgcggcagccgctgacgggctggcacggccatgcgaaaccgttcgacttcacgcac
gactacgcgccgcatccggcgatcgaccggatgctgacgggcactgcgccgcagctcggc
gtgatcgcactcgaagccgcgctcgacgcgttcgacggcgtcgatctcggcgtgctgcgc
gacaagagcgtcgcgctcggcgatttgttcatcgcgctggtcgaccaggagctcgacggt
ctgggcttcacgctcgcgtcgccgcgcgatgccgcgcagcgcggcagccaggtgtcgctc
gcgcacgcgcaagggtacgcgatcgtgcaggcgctgatcgcgcgcaacatgatcggcgac
ttccgcgcgccggacatcctgcgcttcggcttcgcgccgctgtacgtgcgctacgtcgac
gtgtgggacacgatcgccgcgctgaaggacgtcgtcgcgacgggcgcatggaacaccgac
gcattcctcgcgcgcaagtcggtgacctga

DBGET integrated database retrieval system