KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_II0302Help
Entry
BSSP2_II0302      CDS       T03741                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00250  Alanine, aspartate and glutamate metabolism
bsuc00410  beta-Alanine metabolism
bsuc00430  Taurine and hypotaurine metabolism
bsuc00650  Butanoate metabolism
bsuc01100  Metabolic pathways
bsuc01110  Biosynthesis of secondary metabolites
bsuc01120  Microbial metabolism in diverse environments
bsuc02024  Quorum sensing
Module
bsuc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BSSP2_II0302
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSSP2_II0302
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSSP2_II0302
   00430 Taurine and hypotaurine metabolism
    BSSP2_II0302
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BSSP2_II0302
Enzymes [BR:bsuc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSSP2_II0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIB32496
LinkDB All DBs
Position
II:290703..292097
Genome map
AA seq 464 aa AA seqDB search
MTGSNYPARDLIASVFGTEALQEIAASRGFREKEMQANAVYQIIHDELFLDGNARQNLAT
FCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFADNATGTNT
IGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDVEIREIPME
PGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKGLDIDIHVD
AASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEALPEELIFNV
DYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAREIEPLGPY
EFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKASDITVMRV
MCRRGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcaaactatccggcgcgggatttgattgcctctgtttttggcaccgaggct
ttacaggaaattgctgcttcgcgtggttttcgcgaaaaggaaatgcaggcgaacgctgtt
taccagattattcatgacgaactgtttctcgatggtaatgcccgtcagaatctggcgacc
ttctgtcagacatgggatgatgattacgtccacaagctgatggacctttcgatcaacaag
aactggatcgacaaggaggaatatccccagtcggcggccattgatctgcgctgtgtcaac
atggtcgcggacctctggaatgcacccaaattcgccgataatgccacaggcaccaatacg
atcgggtccagcgaggcctgtatgcttggtggtatggccatgaaatggcgctggcgcaag
aagatgcaggaaatgggcaagccgacggacaagcccaatttcgtttgtggcccggtgcag
gtgtgttggcacaaattcgcccggtactgggatgtcgagatccgggaaattccgatggag
cctggccgcctgttcatgggaccagaacaaatgcttgaagccgttgatgaaaataccatc
ggcgtcgtgcccactttcggcgtgacctataccggcaattatgaatttcccgaaccgttg
caggatgcgctggacaagctgcaaaagaccaagggtcttgatatcgatatccatgtcgat
gcggcaagcggcggctttctggcaccattttgcgcgcccgatattccgtgggatttccgc
ctgccgcgcgtgaagtcgatcagcgcgtcaggccataaatacggtctcgcaccgcttggc
tgtggctgggttgtctggcgcgacaaagaggccctgccggaagagctgatcttcaatgtg
gattatctcggtggacaggttggcactttcgcaatcaatttctcgcggcctgccggtcag
gtcatttcacaatattacgaattcatgcgtcttggccgcgaaggctacaccaaggtgcag
caggcggcctaccgcgtggcgcaatatatagccagggagatcgagccgcttgggccttat
gaattcatctgcgcgggcgaggagaaaggcggcattcccgccgtctgtttccgcatccgt
gaaggcgaagaccccggttattcgctctatgatctgtcggaacggctgcgtctgaccgga
tggcaggttcccgctttcgctctttcgggcaaggcgtcggatatcactgtcatgcgcgtc
atgtgccgccgcggtttcgagatggatctggctgcactcttcattcgggatttcaaggct
gggatcgagttcttcaaatcgcatccttcaccgaagattaccccgtcgatgggaaccggc
tttcaccacacataa

DBGET integrated database retrieval system