KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0623Help
Entry
BSSP1_I0623       CDS       T03367                                 

Gene name
hisI
Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsui00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BSSP1_I0623 (hisI)
Enzymes [BR:bsui01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSSP1_I0623 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:complement(616897..617316)
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QVVSSGGKVALTMVSDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggtaagcgatcacgatcaataa

DBGET integrated database retrieval system