KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I1969Help
Entry
BSSP1_I1969       CDS       T03367                                 

Gene name
fabI-2
Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsui00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BSSP1_I1969 (fabI-2)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSSP1_I1969 (fabI-2)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BSSP1_I1969 (fabI-2)
Enzymes [BR:bsui01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BSSP1_I1969 (fabI-2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BSSP1_I1969 (fabI-2)
Lipid biosynthesis proteins [BR:bsui01004]
 Fatty acid synthase
  Component type
   BSSP1_I1969 (fabI-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:complement(1906070..1906888)
Genome map
AA seq 272 aa AA seqDB search
MEGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF
VLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVI
SAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGP
QGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSG
VTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgatgcaaggaaaacgcggcctcatcatgggggtcgcgaacaatcactca
ctggcctggggcattgcaaaacagctcgccgcacagggcgccgaactggccttcacctat
cagggtgatgcgctgggcaagcgcgtgaaacctcttgccgaacaggtcggctcggatttc
gtgctgccttgcgacgtggaggacatcgccaccgtcgatgccgttttcgaagaaatcgag
aagaagtggggcggtctcgatttcctcgtgcacgctatcggtttttccgacaagacggaa
ttgaagggccgctatgcagatgtcaccacgcgcgagaatttcagccgcacgatggtcatc
tccgcctattccttcacagaagtggcgcagcgcgctgaaaagctcatgaaggacggcggc
tcgatcctgacgctgacctatggcggatcgacccgaacgatccccaattacaacgtgatg
ggtgttgccaaggccgctctcgaggccatggtgcgctatcttgcagccgattacggcccg
cagggcatccgcgtcaacgcgatttccgcaggccccgtgcgcacgcttgctggcgccggg
atcggtgatgcccgcgcgattttcagctaccagcgccgcaactcgccgctgcgccgcacc
gtcgatatcgatgatgtcggcaaatcggcagtctatcttctgtccgatctttcaagcggt
gtgaccggcgaaatccatttcgttgattccggctataacatcgtttcgatgccgacgctg
gaagagctgaaaagttcggactccgaacgcggagaataa

DBGET integrated database retrieval system