KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_II0297Help
Entry
BSSP1_II0297      CDS       T03367                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00250  Alanine, aspartate and glutamate metabolism
bsui00410  beta-Alanine metabolism
bsui00430  Taurine and hypotaurine metabolism
bsui00650  Butanoate metabolism
bsui01100  Metabolic pathways
bsui01110  Biosynthesis of secondary metabolites
bsui01120  Microbial metabolism in diverse environments
bsui02024  Quorum sensing
Module
bsui_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bsui00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BSSP1_II0297
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSSP1_II0297
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSSP1_II0297
   00430 Taurine and hypotaurine metabolism
    BSSP1_II0297
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BSSP1_II0297
Enzymes [BR:bsui01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSSP1_II0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIB29123
LinkDB All DBs
Position
II:290618..292012
Genome map
AA seq 464 aa AA seqDB search
MTGSNYPARDLIASVFGTEALQEIAASRGFREKEMQANAVYQIIHDELFLDGNARQNLAT
FCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFADNATGTNT
IGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDVEIREIPME
PGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKGLDIDIHVD
AASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEALPEELIFNV
DYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAREIEPLGPY
EFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKASDITVMRV
MCRRGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcaaactatccggcgcgggatttgattgcctctgtttttggcaccgaggct
ttacaggaaattgctgcttcgcgtggttttcgcgaaaaggaaatgcaggcgaacgctgtt
taccagattattcatgacgaactgtttctcgatggtaatgcccgtcagaatctggcgacc
ttctgtcagacatgggatgatgattacgtccacaagctgatggacctttcgatcaacaag
aactggatcgacaaggaggaatatccccagtcggcggccattgatctgcgctgtgtcaac
atggtcgcggacctctggaatgcacccaaattcgccgataatgccacaggcaccaatacg
atcgggtccagcgaggcctgtatgcttggtggtatggccatgaaatggcgctggcgcaag
aagatgcaggaaatgggcaagccgacggacaagcccaatttcgtttgtggcccggtgcag
gtgtgttggcacaaattcgcccggtactgggatgtcgagatccgggaaattccgatggag
cctggccgcctgttcatgggaccagaacaaatgcttgaagccgttgatgaaaataccatc
ggcgtcgtgcccactttcggcgtgacctataccggcaattatgaatttcccgaaccgttg
caggatgcgctggacaagctgcaaaagaccaagggtcttgatatcgatatccatgtcgat
gcggcaagcggcggctttctggcaccattttgcgcgcccgatattccgtgggatttccgc
ctgccgcgcgtgaagtcgatcagcgcgtcaggccataaatacggtctcgcaccgcttggc
tgtggctgggttgtctggcgcgacaaagaggccctgccggaagagctgatcttcaatgtg
gattatctcggtggacaggttggcactttcgcaatcaatttctcgcggcctgccggtcag
gtcatttcacaatattacgaattcatgcgtcttggccgcgaaggctacaccaaggtgcag
caggcggcctaccgcgtggcgcaatatatagccagggagatcgagccgcttgggccttat
gaattcatctgcgcgggcgaggagaaaggcggcattcccgccgtctgtttccgcatccgt
gaaggcgaagaccccggttattcgctctatgatctgtcggaacggctgcgtctgaccgga
tggcaggttcccgctttcgctctttcgggcaaggcgtcggatatcactgtcatgcgcgtc
atgtgccgccgcggtttcgagatggatctggctgcactcttcattcgggatttcaaggct
gggatcgagttcttcaaatcgcatccttcaccgaagattaccccgtcgatgggaaccggc
tttcaccacacataa

DBGET integrated database retrieval system