KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_16045Help
Entry
Q433_16045        CDS       T03469                                 

Definition
(GenBank) acyl--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q433_16045
   00620 Pyruvate metabolism
    Q433_16045
   00640 Propanoate metabolism
    Q433_16045
  Energy metabolism
   00680 Methane metabolism
    Q433_16045
Enzymes [BR:bsus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Q433_16045
Lipid biosynthesis proteins [BR:bsus01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Q433_16045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2836653..2838242)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPVQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNCYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctgtgcaatataatttagtgaatgaaatggaa
aagttcagtgccgctggacaaaaaaccgctcttctgtgggaggacgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggccttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgagtgctggaagcc
tatgctgtgtatttggctatcctgaaatcaggaatggttgtcattccgtgctccgaaatg
cttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgccatcgtc
tactcagaatttattggcgctttccgtgatgtcagtacggctgacaaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccggg
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgatatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaattgctac
aaaatcaatgttttctgctgtacgccgacagaataccgcttaatggcgaaggtcgagggc
ttggaccgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaacagaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccgggaagc
atgggaaaaccgacaccgggaaaccaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcgagccctgatgaaatcagaggctccatcgta
aaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system