KEGG   Bos taurus (cow): 280969Help
Entry
280969            CDS       T01008                                 

Gene name
ABAT, GABA-AT, GABA-T, L-AIBAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bta  Bos taurus (cow)
Pathway
bta00250  Alanine, aspartate and glutamate metabolism
bta00280  Valine, leucine and isoleucine degradation
bta00410  beta-Alanine metabolism
bta00640  Propanoate metabolism
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
bta04727  GABAergic synapse
Module
bta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    280969 (ABAT)
   00650 Butanoate metabolism
    280969 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    280969 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    280969 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    280969 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    280969 (ABAT)
Enzymes [BR:bta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     280969 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     280969 (ABAT)
Amino acid related enzymes [BR:bta01007]
 Aminotransferase (transaminase)
  Class III
   280969 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 280969
NCBI-ProteinID: NP_001075050
BGD-bta: BT21049
Ensembl: ENSBTAG00000004038
UniProt: A2VDK2
LinkDB All DBs
Position
25
AA seq 500 aa AA seqDB search
MASMLLTQRLVCSFQHNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALMKLVQQPQ
NMSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSSFSKEELETCMVNQAPGCPDYSILSFMGAFHGGTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEELRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLNNAAHAGKVLLTGLL
DLQAQFPQLISRVRGRGTFCSFDTPDESVRNKLISIARNKGLMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagcggctggtctgcagcttccagcacaactaccgcctg
ttggtgccgggatccagacacatcagtcaggctgcagccaaagttgacgttgaatttgac
tatgatggacctttgatgaagacggaagtcccagggcctagatctcgggagctaatgaaa
cagttgaatataattcagaatgcagaggctgtgcactttttctgcaattatgaagagagt
cgaggcaattacctggtggatgtggacggcaaccggatgttggatctttattcccagatc
tcctcggtccctataggttacaaccatcctgctctcatgaaactcgttcaacagcctcaa
aatatgagcacattcatcaacagacctgccctcggaatccttcctccggagaactttgtg
gagaagctccgggagtccctgctctcggtggctcccaaagggatgtcccagctcatcacg
atggcctgcggctcctgctccaacgagaacgccttcaagaccatcttcatgtggtaccgg
agcaaggaaaggggccagtcgagtttctccaaagaggagctggagacgtgcatggtcaac
caggcccctgggtgccctgactacagcatcctctccttcatgggtgctttccacgggggg
accatgggttgcttagcaaccacgcactccaaagccattcacaagatcgacatcccctcc
ttcgactggcccatcgcaccgttcccacggctgaaatatcctctggaagagtttgtgaaa
gagaaccaacaagaagaggcccgctgtctagaagaggtggaggacctgatcgtgaaatac
cggaagaagaagaggacggtggccggcatcattgtggagcccatccagtctgagggcgga
gacaaccacgcgtcggacgacttcttccggaagttgagagacatctccaggaagcacggc
tgtgccttcttggtggacgaggttcagactggaggaggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgaccccgcggacgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttgcggcccaacgctccttaccggatcttcaac
acgtggctgggagacccatccaagaacctgctgctggccgaggtcatcaatgtcatcaag
cgagaggacctgctgaacaacgcagcccatgctgggaaggtcctgctcacaggactgctt
gacctccaggcccagttcccccagctcatcagcagagtcagagggcgaggcaccttctgc
tccttcgacactccagacgaatccgtgcggaataaactcatttcaatagccagaaacaaa
ggcctgatgctggggggctgcggcgacaagtccatccgcttccgtcccactctggtcttc
cgagatcaccacgcccacctgttcctcaacatctttagtgacatcctagctgacttcaag
taa

DBGET integrated database retrieval system