KEGG   Bos taurus (cow): 286850Help
Entry
286850            CDS       T01008                                 

Gene name
GNG12
Definition
(RefSeq) G protein subunit gamma 12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04062  Chemokine signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04371  Apelin signaling pathway
bta04713  Circadian entrainment
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04810  Regulation of actin cytoskeleton
bta04926  Relaxin signaling pathway
bta05032  Morphine addiction
bta05034  Alcoholism
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    286850 (GNG12)
   04010 MAPK signaling pathway
    286850 (GNG12)
   04371 Apelin signaling pathway
    286850 (GNG12)
   04151 PI3K-Akt signaling pathway
    286850 (GNG12)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    286850 (GNG12)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    286850 (GNG12)
  Endocrine system
   04926 Relaxin signaling pathway
    286850 (GNG12)
  Nervous system
   04724 Glutamatergic synapse
    286850 (GNG12)
   04727 GABAergic synapse
    286850 (GNG12)
   04725 Cholinergic synapse
    286850 (GNG12)
   04728 Dopaminergic synapse
    286850 (GNG12)
   04726 Serotonergic synapse
    286850 (GNG12)
   04723 Retrograde endocannabinoid signaling
    286850 (GNG12)
  Environmental adaptation
   04713 Circadian entrainment
    286850 (GNG12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    286850 (GNG12)
  Substance dependence
   05032 Morphine addiction
    286850 (GNG12)
   05034 Alcoholism
    286850 (GNG12)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    286850 (GNG12)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   286850 (GNG12)
  Exosomal proteins of colorectal cancer cells
   286850 (GNG12)
GTP-binding proteins [BR:bta04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    286850 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 286850
NCBI-ProteinID: NP_777210
BGD-bta: BT20985
Ensembl: ENSBTAG00000035697
UniProt: Q28024
LinkDB All DBs
Position
3
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRMEASIERIKVSKASADLMSYCEEHARNDPLLMGIPTSE
NPFKDKKTCTIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaagacagccagtaccaacaacattgcccaggcacggaggactgtgcagcag
ttgagaatggaagcctccattgagagaataaaggtttcaaaggcatcagcagacctcatg
tcctactgtgaggaacatgccaggaatgaccctctgctgatggggataccaacttcagaa
aaccccttcaaggataagaagacctgcaccatcttatag

DBGET integrated database retrieval system