KEGG   Bos taurus (cow): 505080Help
Entry
505080            CDS       T01008                                 

Gene name
TGM3, TG(E), TGE
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     505080 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 505080
NCBI-ProteinID: NP_001095318
BGD-bta: BT28536
Ensembl: ENSBTAG00000001785
UniProt: A6QP57
LinkDB All DBs
Position
13
AA seq 691 aa AA seqDB search
MSGLQSVDWQIASNRQAHHTERFYGKDLLVRRGQLFQVSLTLSQGLSSGGRVTFTASTGP
YPSESANTKAVFPLSNGTSSSGWGAQLVSSRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSTLKLGTFILLFNPWLQADSVFMSNHAEREEYVQEDAGIIFVGSTNRISMIGWNYGQF
EEGILNICLSVLDNSLNFRRDPATDVAHRNDPKYVGRVLSAMINGNDDSGVISGNWSGSY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDQNLSVDVYYDPLGRPMDKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESNGALKKNSADTHSVGKH
ISTKAVGSNSRMDVTEKYKYPEGSSQERQVFEKALRKLKPTMSFSATSASSLAREEREPS
ISGRFKVAGVLTVGKEVNLILMLKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKIAYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDIILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGNLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactccagagtgtcgactggcagatagcctccaaccggcaggcacatcacaca
gagaggttctatggcaaggatctcctggtacggagaggccaactcttccaagtgtcactg
accttatcccaaggtctcagctctggaggacgtgtgacattcacagcttccacagggcct
tacccctcagagtcggccaatacaaaggctgtgtttccactctccaatgggacaagtagc
agcggctggggtgcacaacttgtgtccagcaggaacaatgttctgaacatctccatcctt
agtcctgcaaatgcacccattggaaggtacacgctaaacatgcagatctcctcccagggc
agtgactccacgctgaaacttgggacattcatactgctctttaacccctggttgcaagct
gatagtgtctttatgagtaaccatgctgagagagaggaatatgttcaggaagatgctggc
atcatctttgtgggaagcacaaatcgaattagcatgattggctggaactacggacagttt
gaagaaggcatcctgaacatttgcctctcagtcctggataacagtctgaattttcgccgt
gaccctgctacggatgtggcccacagaaacgatcccaaatatgttggccgggttctcagt
gcaatgatcaatggcaatgatgacagtggcgtgatttctgggaactggagcggtagctac
actggtggccgggatcctaggaactggaatggcagcgtggaaatcctcaaggagtggcaa
agatctggcttcaggcctgtccgatatggccagtgctgggtctttgctggaaccctcaac
acagtgttgcgatgtttggggattccctcccgagtgatcaccaacttcaactcagctcat
gacacagaccaaaacctcagtgtggatgtctactacgaccccttgggacggcccatggac
aaaggcagtgatagtgtgtggaatttccacgtctggaatgaagcctggtttgtgcggtct
gacctgggcccttcgtacaatggatggcaggttctggacgccacccctcaggagagaagc
caaggggtgttccagtgcggccctgcttcggtgatcgctatccgagagggtaacgtggac
tgggacttcgacatgcccttcatctttgcggaggtcaatgccgaccgcatcacatggatc
tacgagtcgaacggtgccttgaagaagaattccgcagacactcacagcgtcggcaagcac
atcagtaccaaggcggtgggcagcaactctcgcatggatgtcaccgaaaagtacaagtat
ccagaaggttccagccaggaaagacaagtatttgaaaaggctttgaggaaacttaaaccc
acaatgtcatttagtgcaacatctgcaagcagcctggcaagagaggaacgggagcctagc
atctctgggaggttcaaggtcgctggtgtactgacagtgggcaaagaagtcaacctgatc
ctaatgctcaaaaacctaacaagtgatacaaagacagtgacagtgaatatgacagcctgg
accatcgtctacaacggcacacttgtacacgaggtgtggaaggactctgtcactaaatcc
ctgaatcccgaagaagaaatagagcaccctgtaaagattgcatatgctcagtacgagaag
tacctgaaggcggacaacatgatccggaccacagccgtgtgccaggtcaccgatgagcct
gaggtggtggtggagagggacatcatcctggacaaccccaccttgacccttgaggtgctg
gatgaggcccgggtgcagaagcctgtgaacgtgcagatgctcttttccaacccactggat
gagcccgtgaaggactgcgtgctgatggtggagggcagcggcctgctgctgggcaatctc
aagatcgacgtgccagccctgcgtcccaaagagcggtcccgcgtgcgttttgagatcctg
cccacccggagtggcaccaagcagctccttgccaacttctcctgcaacaagttccccgca
atcaaggccatgctgtccgttgatgtggctgagtga

DBGET integrated database retrieval system