KEGG   Bos taurus (cow): 509382Help
Entry
509382            CDS       T01008                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    509382 (SETDB2)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     509382 (SETDB2)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     509382 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    509382 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
12
AA seq 700 aa AA seqDB search
MGEKNGDAKSFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVKDAI
INHNSTLIKDHRSVTKNAEENKSSSLPSTSYEDFFPKDCTSLSTENQEIPPMENKVADFR
EKESSLNLSYQKHQCSGSCLMKMPFTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNMEEVFRYLLETECNFLFTDNFSFNTYAQLTRNYPKEEEIVSDVDISNGVES
VPISFCNEIDNRKLPQFKYRKTMWPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSNNKITTGYKYKRLERQIPTGIYECSLLCKCDRRICQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSDTEKPDAIDENGKEENIMKNMFSRKRKI
EVADCEVEVIPIELEARPRSMETQEYPPKLHNNTKEPITGMKYNSISRIRYHSVIRSPKT
KTVIIQHNGKNMGFTSSESVTSEDNGELNPAQVHLNSKAKEMRKDSSSNQVEDCKDSPVI
DSDVIDITKCREDTPPGDTCHQAVTLDNKNEVQIQKPQEEKSPACQNHQVFCGKELPNET
KDASSDSLEKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVAFFT
NRYVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRRKIL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaagtttctggatggagctggaagatgatgggaaa
gtggatttcatatttgaacaagtgcaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccacaaataaagaatacatccaagcaatgattctagtaaaagatgcaatt
ataaaccacaattcaacattgataaaggatcatagatctgtgaccaagaacgcagaagaa
aacaagtcaagttcattgccctcgacatcatatgaagacttctttccaaaagactgcacc
tctctatctacagaaaaccaggaaattccccctatggaaaataaagttgcagactttaga
gaaaaagaatcttctttaaatttatcttaccaaaagcatcagtgctctggctcctgtctg
atgaaaatgccatttaccttcaagggggaaaaccctctgcagctaccaatcaaatgccat
ttccaaagacgacacgcgaagacaaactctcattcttcagcactccacgtgagttataaa
accccttgtggaaggagtctgcgaaacatggaggaagtttttcgttacctgcttgagaca
gagtgtaactttctatttacagataacttttctttcaatacctatgctcagttgactcgg
aattacccaaaggaagaagaaattgtttctgatgtggatattagcaatggcgtggaatcg
gtgcccatttctttctgtaatgaaattgacaatagaaaacttccacagtttaagtacaga
aagactatgtggccacgagcatattatctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgtgcatgtcttcaactgacagca
aggaatgccaagacttgccccttgtcaaataataaaataaccactggatataaatataaa
agactagagagacagatacctactggcatttatgaatgcagcctattatgcaagtgtgat
cgacgaatatgtcaaaaccgagttgtccagcatggacctcaagtgaggctacaagtgttc
aaaactgagaagaagggatggggagtgcgctgtctagatgacattgacagagggacgttt
gtttgcatttattcaggaagattactaagcagatctgacactgagaaacctgatgctatt
gatgaaaatggaaaagaagagaatattatgaaaaatatgttttccagaaagaggaaaata
gaagttgcagattgtgaggttgaagttatcccaatagaactggaagcacgtcctagaagt
atggagactcaggagtatccacctaagctccataataataccaaagagcctattacagga
atgaaatataacagcatttcaagaattcgatatcattctgtcataagaagtcctaaaacc
aagaccgtcattattcaacacaatgggaaaaatatgggatttacttcctcagagtctgtc
acctcagaagataatggggaacttaatccagctcaagtacatctgaactctaaagccaag
gaaatgagaaaggactcaagctcaaaccaagttgaagattgtaaagacagccctgtgatt
gattccgatgtgatagatataaccaagtgtagagaagacactccgccaggggacacatgt
caccaagcagtcacactggataacaagaatgaggttcaaatacaaaagccccaagaggaa
aaatctccagcatgtcaaaaccatcaggtcttttgtggtaaagagttaccgaatgaaacc
aaggatgcttcatctgattctctagagaagttcaataaagggaatgtgtttctattggat
gccacaaaagaaggaaatgtgggccgcttccttaatcatagttgttgcccaaatcttttg
gtacagaatgtttttgtagaaacacatgacagaaattttcccttggtggcgttcttcacc
aacaggtatgtgaaagcaagaacagaactaacatgggattatggttatgaagctgggact
atgcctgagaaagaaatcctctgccaatgtggggttaataaatgcagaagaaaaatatta
taa

DBGET integrated database retrieval system