KEGG   Bos taurus (cow): 528030Help
Entry
528030            CDS       T01008                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
bta  Bos taurus (cow)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    528030 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    528030 (NEU4)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     528030 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
LinkDB All DBs
Position
3
AA seq 478 aa AA seqDB search
MGTPRVPARTVLFQRERTGLTYRVPALLFAPPGPTLLAFAEQRLSPDDAHAHRLVQRTGT
LAGGSVRWGAPRVLGTAALDEHRSMNPCPVHDERTATVFLFFIAVRGRTPEAAQIASGRN
AARLCCVTSRDAGRSWGGARDLTAEAVGSAEQDWATFAVGPGHGVQLRSGRLLVPAYTYH
VVRRECFGRICRTRPQSFAFYSDDHGRTWQRGGLVPSLRSGECQLAAVDGGRAGGVLYCN
ARSPLGSRVQALSVDEGTSFLPGELVPALAETARGCQGSIVGFPAPPASGWKDEGWSAGT
SNPLRLPHLCPGAREAPEEGTGDTRGGGGLGGMEGCGNGPREPGENWGSWASVLLGPLAA
LSQSPTWLLYSHPVGRRARLHMGVRLSRSPLDPHSWTEPWVIHQGPSGYSDLASIGPAPG
GVPTFACLFESGARVSYEEISFCMFSLQEVLENVRLGGVHPGPGDKPGDKPAGRCQPS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggggaccccgcgtgtccccgcgcggaccgtccttttccagcgcgagcggacgggcctg
acctaccgcgtgcccgcgctgctcttcgcgccccccgggcccaccctgctggccttcgcg
gagcagaggctcagccccgacgacgcccacgcccaccgtctggtgcagaggaccggcacg
ctagccgggggctccgtgcggtggggcgccccgcgcgtgctggggacggcggccctggac
gagcaccgctccatgaacccctgcccggtgcacgatgagcgcacggccacggtcttcctc
ttcttcatcgccgtgcgtggccgcacccccgaggccgcgcagatcgcctcgggcaggaac
gccgcgcgcctctgctgcgttaccagccgggacgcggggcgcagctggggcggcgcgcgg
gacctcacggcggaggcggtgggcagcgctgagcaggactgggccacgtttgccgtgggg
cctggccacggcgtgcagttgcgctctggccgcctgctggtgccggcctacacctaccac
gtggtccggcgggagtgcttcggccggatctgcaggacccgcccccagtccttcgcgttc
tacagtgatgaccacggccgcacctggcagcgcgggggcctcgtgcccagcctgcgctcg
ggcgagtgccagctggccgcggtggacggcgggcgggccggtggcgtcctctactgcaat
gctcggagccccctgggcagccgcgtgcaggccctcagcgtggacgagggcacctccttc
ctgcccggggagctggtgcctgccctggccgagaccgcccggggctgccagggcagcatc
gtgggcttcccggccccacccgccagcgggtggaaggatgaggggtggtccgcgggcacc
agcaaccctctccgccttccgcacctctgtcctggggccagggaggccccagaggagggc
actggagacacccgtgggggcggggggctgggtgggatggagggctgtggcaacggcccc
agggagcctggtgagaactggggctcctgggcctcagtgctcctgggacctcttgcagcc
ttgtcgcagagccccacgtggttgctgtactcccacccagtggggcgcagggctcggctc
cacatgggtgtccgcctgagccggtccccgctggacccccacagctggacggagccctgg
gtcatccaccagggccccagtggctactcggacctggcatccatcgggcctgcccctggg
ggcgtcccgaccttcgcctgtctgttcgagagtggggccagggtctcctatgaggagatc
tccttctgcatgttttccctgcaggaggtcctggagaacgtgaggctagggggagtgcac
cccggccctggagacaagcctggagacaagcctgcggggcgctgccagccctcctga

DBGET integrated database retrieval system