KEGG   Bos taurus (cow): 786335Help
Entry
786335            CDS       T01008                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
bta  Bos taurus (cow)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    786335 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    786335 (GYS1)
   04152 AMPK signaling pathway
    786335 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    786335 (GYS1)
   04922 Glucagon signaling pathway
    786335 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    786335 (GYS1)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     786335 (GYS1)
Glycosyltransferases [BR:bta01003]
 Polysaccharide
  Storage polysaccharide
   786335 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
18
AA seq 736 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDDERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcgggatctacacagtgctgcagacgaaggcaaaggtgacgggggacgagtggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgaccccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgattgaggggggccccctggtggtgctcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacacgtggtcgcacacttccac
gagtggttggcaggtgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgctggggctgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgcgctcatgtcttcactactgtgtcccag
attaccgccattgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggggctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagtgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacggccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatctttgccacacagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctctttaatagtagtgctgacagagtcaaggtgatttttcacccggag
ttcctgtcttctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgaatgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagtctg
gatgattcctgctcgcagctcacctccttcctctacagtttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgaccttctggactggaaatac
ctaggccggtactacatgtcagcgcgccacatggcgctggccaaggcctttccagaatac
ttcacctacgagcctcacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcgctgtcgcgacactccagcccgcaccagagcgaggatgag
gaggaaccccgggacttaccacctgatgaagatgacgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgcccccgagtggccacgccgcgcctcctgcacc
tcttccaccgggagcaagcgtgggtctgtggacacagcgccctccagctcagtcagcacc
cccagcgaaccccttagccccgccagctccctgggcgaggaacgcaactaa

DBGET integrated database retrieval system