KEGG   Bacillus thuringiensis BMB171: BMB171_C0524Help
Entry
BMB171_C0524      CDS       T01239                                 

Definition
(GenBank) bacillolysin
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
btb  Bacillus thuringiensis BMB171
Brite
Enzymes [BR:btb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BMB171_C0524
Peptidases [BR:btb01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BMB171_C0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
610851..612551
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVTNEDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRTTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGATSAEVAAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacatttgga
gggacaggctctgcatttgcggattctaaaaatgtactctctacgaagaagtacaatgag
acagtacagtcacctgagtttatttctggtgatctaactggagcgactggtaagaaagcg
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattacaagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtacctgtatggggttctactcaagtagct
cacgtaagtaaagacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aagaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcgattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatacgttgtaaatctaaacttcttagatcca
agtccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtaacaaatgaagataaatcaccagttaagcaagaggctcctaaa
caggatgcgaaagcagtagtaaaacctgtaacaggaacaaataaagtaggaactggtaaa
ggtgtattaggagatacaaaatcacttaatacaacgttatctggttcatcttactacttg
caagataatacgcgcggggcaacaattttcacatatgatgcgaaaaatcgtactacattg
ccaggaactttatgggtagatgcagataatgttttcaatgcagcgtatgatgcagcagca
gtagatgctcattactatgcaggtagaacatatgattattataaagctacatttaacaga
aactctattaatgatgcaggagctccgttaaaatcgacagttcattacggaagtaagtat
aataatgcattctggaatggctcacaaatggtatacggagatggtgatggtgtaacattc
acttcattatctggtggaattgatgtaattggtcacgaattaacgcatgctgttactgaa
aatagctcggacttaatttatcaaaatgaatcaggagcgctaaatgaagcaatttctgat
atttttggtactttagtagaattctatgataaccgtaacccggattgggagattggtgaa
gatatttatacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccagcgaaa
tacggtgatccagaccattattctaagcgttacactggtactagtgataacggtggggtt
catacaaacagtggtatcattaacaaacaagcttatttattagcaaatggtggtacgcat
tcgggtgtaactgtaacgggcattggtaaagataagttaggtgcaatttattaccgtgca
aatacacaatatttcacgcaatctactacatttagccaagctcgtgctggtgcagtacaa
gctgcagctgatttatatggtgcgacttctgcggaagtagcagcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system