KEGG   Bacillus thuringiensis BMB171: BMB171_C3628Help
Entry
BMB171_C3628      CDS       T01239                                 

Gene name
tgl
Definition
(GenBank) transglutaminase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
btb  Bacillus thuringiensis BMB171
Brite
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BMB171_C3628 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3865312..3866142
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEVYSFRTADELSFDLNLRVNIIISA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLRLITKNGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYSLNERRVPYAFISAFLTDTITRIDSR
IMSQYASSSTPQTSISFIPIRDDAIVATVGHTTTIY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatattacaaatgaatacgagccattt
gcagcagagaaacaacaaattttatcaataatggcaggaaatcaagaagtttattccttc
cgaacagctgatgaactcagctttgatctcaatttacgagttaatattattatctctgca
ctagagctttttcaaagtggatttcagtttcgtacatttcagcaatccttttgcaacccc
cagtattggaaaagaacgtctcttggaggattcgagcttcttccaaacataccaccttct
attgccatacaggatattttcaaaaacggaaaactatatggaactgaatgcgcaaccgct
atgatcattattttttataaagctttactatcattgtatgaggaagaaactttcaatcgt
ctatttgcaaaccttttactttatacatgggactacgaccaagatctaaggctcataaca
aaaaacggtggcgatcttgttccaggtgacctcgtttactttaaaaacccacaagtaaat
ccagctacgattgaatggcaaggagaaaatacaatctatttaggaaatttctttttttac
gggcatggcgtaggtgtaaaaacaaaagaagaaattatttattcattaaatgaacgacga
gtcccttacgcttttatttcagctttcttgaccgatactattacccgtatcgatagtcgt
ataatgagccaatacgcttcttctagtacaccacagacctccataagctttattccgatt
agggatgatgcaatcgttgcaacagttggtcatacaactacaatttattaa

DBGET integrated database retrieval system