KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0522Help
Entry
CT43_CH0522       CDS       T01838                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Brite
Enzymes [BR:btc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     CT43_CH0522
Peptidases [BR:btc01002]
 Metallo Peptidases
  Family M4: thermolysin family
   CT43_CH0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AEA14214
LinkDB All DBs
Position
605177..606877
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPIKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRTTL
PGTLWLDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGASSAEVNAVKQSFSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcatttgcggattctaaaaatgtactctctacgaagaagtacaatgag
acagtacagtcacctgagtttatttctggtgatttaactggagcgactggtaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtacctgtatggggttctactcaagtagct
cacgtaagtaaagacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaggaaaagttaaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatatgttgtaaatctaaatttcttagatcca
agtccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataaatcaccaattaagcaagaggctcctaaa
caggatgcgaaagcagtagtaaaacctgtaacaggaacaaataaagtaggaactggtaaa
ggtgtattaggagatacgaaatcactcaatacaacattatctggctcatcttactactta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaatcgtactacattg
ccaggaactttatggttagatgcagataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcattactatgcaggtaaaacatatgattattataaagctacatttaataga
aactctattaatgatgcaggggcaccgttaaaatcaacagttcattacggaagtaagtat
aataatgcattctggaacggctcacaaatggtatacggagatggagatggtgtaacattc
acttcattatctggtggaattgacgtaattggtcacgaattaacgcatgctgttacggaa
aatagctcggacttaatttatcaaaatgaatcaggagcgttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccagattgggagattggtgaa
gatatttacacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccagcgaaa
tatggtgacccagaccattattctaagcgttacactggtactagtgataacggtggggtt
catacaaacagtggtatcattaacaaacaagcttatttattagcaaatggtggtacgcat
tcgggtgtaactgtaacgggcattggtaaagataagttaggtgcaatttattaccgtgca
aatacacaatatttcacgcaatctactacatttagccaagctcgtgctggtgcagtacaa
gctgcagcggatttatatggtgctagctctgcagaagtaaatgcagtgaagcaatcattt
agtgctgttggtgtaaattaa

DBGET integrated database retrieval system