KEGG   Burkholderia thailandensis MSMB121: BTI_5422Help
Entry
BTI_5422          CDS       T02644                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase family protein
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTI_5422
Enzymes [BR:btd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTI_5422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(2262079..2262735)
Genome map
AA seq 218 aa AA seqDB search
MISEKIHVAHGALQSGFDGFRSNSLTDSTLRGRPAIEILDIASRLLNVQSLERSGVPAVI
IEDKTGLKKNSLLGNDVIQHQESIDDFQIIACVESLILDKGMPAALARAAAYCEAGADGV
MIHSRKKDADEVIEFAQRFRERRSDAYLACVPTSFNAISFSELARYFSVVIYANHLLRAA
SPAMLAVAEGIVAHGRTLEIEERCLPVNEILKLIPGTA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgaaaaaattcatgttgcgcacggagcgctgcaatccgggttcgacggcttc
cggtcgaattcattgaccgactcgacgctgcgcggccggccggccatcgaaatcctggac
atcgcgagcaggctgctgaacgtccagtcgcttgagcgatccggcgtcccggcggtgatt
atcgaagacaaaacggggttgaagaaaaattcgctgctcggcaacgacgtgattcagcac
caggaatcgatcgacgattttcagatcattgcctgcgtcgaaagcctgattctcgacaag
ggcatgccggccgcgctcgcgcgcgcggccgcgtattgcgaggccggcgccgacggcgtg
atgatccatagccgcaagaaggacgcggacgaagtcatcgaattcgcgcaacggtttcgc
gagcgccgtagcgacgcgtatctcgcgtgcgtgccgacgagtttcaacgcgatttcgttc
agcgagctcgcgcgctacttcagcgtcgtgatctacgcgaatcacctgctgcgcgccgca
tctccggcgatgctagcggttgccgaaggcatcgtcgcgcacggccgaacgctcgagatc
gaagagcgctgcctgccagtcaacgagatcctgaagctcatccccggaaccgcgtga

DBGET integrated database retrieval system