KEGG   Burkholderia thailandensis E264: BTH_II0943Help
Entry
BTH_II0943        CDS       T00311                                 

Definition
(GenBank) AMP-binding domain protein
Organism
bte  Burkholderia thailandensis E264
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:1114187..1117294
Genome map
AA seq 1035 aa AA seqDB search
MTVAARERIAARSTSGVSAHVASRGGSASRARRRGALAFAPLVDATQAVRRGTAHADDRR
RAIRRAAKRADTADARRRCARSPIIERATSMEHTQRLSDNATRLLALIDALLAELYGERN
GHGRATLDARFERDLGFDSLTRAELFDRIERAFGVRLPVDVFASAATPADVVRALAAAHA
QPQAAPEGEAGPAPPADAAAWPVEADTLIDVLNWHAERHPDRVHLRLLEDGLVATPLAYG
ELHRRASDLAGGLRERGIDPGDTVALMLPTGLDYFVSFTAVLFCGAIPVPIYPPANPAQL
EEHVERHTPILENARIKALIAFRQAVSVAQLLKLRVSTLQHVFTPEQLVGRERLPPFRAA
ASDIALLQYTSGSTGTPKGVVLSHANLLANIRAMGDRMHVYATDVLVSWLPLYHDMGLIG
AWLAPLYFGIPAVVMSPVAFLARPALWLRAISRYHGTITAAPNFAYERCARHLAALEPTE
FDLSSLRFAFCGAEPVNADTLRAFAARFAACGFDARALTPVYGLAENTLGLTFPPPARGL
HVDRIARAPLNASGQAVPAPGDANALDVPGCGYPIDGTELRIVGDDERELAERRVGRIEF
RGTSATRGYYRNPAQTARLFHDAWRDTGDLGYVADGELYITGRAKDMIIRGGQHFFPYEL
EEAIGRLPGVAAGGVAVCGAADPASGTERVVIFVESEAADGAACERLRANVNDVTAARWG
MPAEQVSIVAPHSILKTPSGKIRHAATLAQFERCAGRLPQASAPWRQFADLAVRSVAPFC
SRVSRRAAQALRGLCCWALVALLAPVLWVRVAYRNDTRDNWRLAAQACRAFLRFADVRAS
LIADPDALAAGPSIVVANHTSYLDVVALLALLPSPVHFVAKRELATRPFVGRFLRALGTR
FVERRDYGRSVEDEARLVAQAAADETLLFFPEGTFTRAAGLAAFRLGAFRAACIARRPVV
PVVVSGARAVLRDGEWAPRRGEIAVTMLAPIFPDGTDFGAMARLRDRARDAILSRCGEPD
LRADRAPRAAFASVA
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgccgcgcgcgagcgcattgccgcgcgatcgacgagcggtgtttccgcccac
gtcgcctcgcgcggcggctcggcctcgcgcgcgaggcgacgcggcgcgctcgcgtttgcg
ccgctcgttgacgcaactcaagccgttcgtcgcgggacggcgcacgctgacgatcggcgt
cgcgcgattcgtcgcgcggcgaagcgagcggatacggcggatgcgcgccgccgctgcgcg
cggtctccgatcattgaacgggcgacaagcatggaacacacgcagcgcctatccgacaac
gcgacgcgtctgctcgcgctgatcgacgcattgctcgccgagttgtacggcgagcgaaac
ggtcatggccgcgcgacgctcgatgcgcggttcgagcgcgatctcggcttcgacagcctg
acgcgcgcggagctgttcgaccggatcgagcgcgcgttcggcgtgcgcttgccggtcgac
gtgttcgcgtccgccgcgacgcccgccgacgtcgtgcgcgcgctcgccgcagcgcacgcg
cagccgcaggccgcgccggaaggcgaagcggggccggcgccgcccgccgatgccgccgca
tggcccgtcgaggccgacacgctgatcgacgtgttgaactggcatgccgagcggcatccg
gatcgcgttcatctgcggcttctcgaagacggcctcgtcgcgacgccgctcgcttacggc
gaactgcatcggcgcgcgtcggatctggcgggcggcttgcgcgaacgcggcatcgatccg
ggcgacacggtcgcgctgatgctgccgacggggctcgactatttcgtctcgttcaccgcc
gtcctgttttgcggcgcgatcccggtgccgatctatccgcccgcgaatcccgcgcagctc
gaagagcatgtcgagcgccacacgccgattctcgagaacgcccggatcaaggcgctgatc
gcgtttcgccaggccgtctcggtcgcgcagttgctgaagcttcgcgtgagcacgctgcag
cacgtgttcacgcccgagcagctcgtcggccgcgagcggctgccgccgtttcgcgcggcc
gcgagcgacatcgcgctgctccagtacacgtcgggcagcaccggcacgccgaagggcgtg
gtgctcagccatgcgaacctgctcgcgaacatccgcgcgatgggcgaccggatgcatgtc
tacgcgaccgacgtgctcgtgagctggttgccgctgtatcacgacatgggattgatcggc
gcatggctcgcgccgctttatttcggcattccggcggtcgtgatgtcgcccgtcgcgttc
ctcgcgcgtccggcgctgtggctgcgcgcgatctcgcgataccacggcacgatcaccgcc
gcgccgaacttcgcgtacgaacggtgcgcgcgccatctcgccgcgctcgagccgaccgaa
ttcgatctgtcgtcgctgcgtttcgcattctgcggcgccgagcccgtcaacgccgacacg
ctgcgcgcgttcgcggcgcgcttcgccgcgtgcggtttcgacgcgcgcgcgctgacgccc
gtctacggtctcgcggaaaacacgctcggcctgacgtttccgccgcccgcgcgcgggctg
catgtcgatcggatcgcccgcgcgccgctcaacgcgagcggccaggcggtgcccgcgccc
ggcgacgcgaacgcgctcgacgtgccgggctgcggctatccgatcgacggcaccgagctg
cggatcgtcggcgacgacgagcgcgagcttgccgagcggcgggtggggcgcatcgagttt
cgcggcacgtcggcgacgcgcggctactaccgcaatccggcgcagaccgcgcgcctgttc
catgacgcatggcgcgacaccggcgacctcggctatgtcgcggacggcgagctgtacatc
accgggcgcgcgaaggacatgatcatccgcggcggccagcatttctttccgtacgagctc
gaggaggcgatcggacggctgccgggcgtcgcggcgggcggcgttgcggtgtgcggcgcc
gccgaccccgccagcggcaccgagcgcgtcgtgatcttcgtcgagagcgaggccgccgac
ggcgccgcgtgcgagcggctgcgggcgaacgtcaacgacgtgacggccgcgcgctggggc
atgcccgccgaacaggtgagcatcgtcgcgccgcacagcatcctgaagacgccgagcggc
aagatccgccacgcggcgacgctcgcgcagttcgagcgctgcgccggacggttgccgcaa
gcgagcgcgccgtggcggcaattcgccgatctggcggtgcgcagcgtcgcgccgttctgc
tcgcgcgtttcgcggcgcgcggcgcaggcgctgcgcgggctgtgctgctgggcgctcgtc
gcgctgctcgcgcccgtgctgtgggtgcgcgtcgcgtatcggaacgatactcgggacaac
tggcggctcgcggcgcaagcgtgccgcgcgttcctgcgtttcgccgacgtgcgcgcgagc
ctgatcgccgatcccgacgcgctcgcggccgggccgtcgatcgtcgtcgcgaaccatacc
agctacctggacgtcgtcgcgctgctggcgttgctgccgagtcccgtgcacttcgtcgcg
aagcgcgagctcgcgacgcgcccgttcgtcggccgcttcctgcgcgcgctcggcacgcgc
ttcgtcgagcggcgcgattacgggcgcagcgtcgaggacgaagcgcggctcgtcgcgcag
gcggccgccgacgagacgctgctgttttttccggaaggcacgttcacgcgcgcggcgggg
ctcgccgcgttccgcctcggcgcgtttcgcgcggcgtgcatcgcgcggcggccggtggtg
cccgtcgtcgtgagcggcgcgcgcgccgtgttgcgcgacggcgaatgggcgccgcgccgc
ggggagatcgcggtgacgatgctcgcgccgatcttcccggacggcacggacttcggcgcg
atggcgcggcttcgcgatcgcgcgcgcgatgcgattctgtcgcgctgcggcgagcccgac
ttgcgggccgatcgcgctccgcgcgcggcgttcgcgtcggtcgcgtaa

DBGET integrated database retrieval system