KEGG   Bombus terrestris (buff-tailed bumblebee): 100646662Help
Entry
100646662         CDS       T04364                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:bter00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100646662
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100646662
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100646662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 151 aa AA seqDB search
MVKAVCVLQGEVKGTLYFEQSDSSSPVKVTGQVTGLKQGLHGFHIHEFGDNTNGCTSAGP
HFNPLKKDHGGPDAEVRHVGDLGNVEANANGIANVNITDKVIQLQGPHNIIGRTLVVHAD
PDDLGKGGVELSKTTGNAGARLACGVVGIAA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggccgtgtgtgttcttcagggtgaagtcaaaggcactctctacttcgaacaa
tcggacagttctagtccagtcaaggttacaggtcaagtaaccggtttaaaacaaggattg
catggttttcacattcacgaattcggtgataacactaacggttgtacaagtgctgggcca
catttcaatccgttaaaaaaggatcatggcggtcctgatgcagaagtacgtcatgttgga
gatttaggaaatgttgaagcaaatgcaaatggtattgctaatgtcaatataactgacaaa
gtcatccaactccaaggaccacacaacattattggcagaacattggtggttcatgcagat
ccagatgaccttggtaaaggtggagttgaattatcaaaaacaacaggaaatgctggagct
cgtcttgcttgtggtgttgttggaattgcagcctaa

DBGET integrated database retrieval system