KEGG   Bombus terrestris (buff-tailed bumblebee): 100646690Help
Entry
100646690         CDS       T04364                                 

Definition
(RefSeq) trypsin-2
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bter00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100646690
Enzymes [BR:bter01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100646690
Peptidases [BR:bter01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100646690
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100646690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 251 aa AA seqDB search
MLRIVLLAAFIVGCLGSVPKPVSLFPDSQIIGGSEVDIGQHPHQLSLQTSGHICGGSIIS
SNWAITAAHCVGSAPSRYTVRVGSSHKDLGTRYRIKNIIRHPQYNSRTIDYDVALLEIDG
TIKFDTNVRPIEPANTEPLPNKMVNVTGWGALREGGSTSAQLMKVSVPIVSKSECGDAYK
YMNEITDRMLCAGYTSGGKDACQGDSGGPLTGDGILYGLVSWGYGCAKPNYPGVYTNVAN
LRSWIKAHSGV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaattgttttactcgctgctttcatcgtcgggtgcctcggctctgtgccgaag
ccggtctctctgtttccggactctcaaatcatcggaggaagcgaggtcgacataggtcaa
catccgcatcaactgagtttgcaaactagcggacacatttgcggtggctcgatcatcagt
agtaattgggccatcactgcagctcattgcgtgggatcagctccgagtcgatatactgta
cgagttggtagcagtcacaaagacttgggcactcgttatagaataaaaaatatcattcga
caccctcagtacaattcgcgaaccatcgattatgacgtcgcccttttggagattgatggc
acaatcaagtttgatacgaatgtgcgacctatagaaccggcaaacacggaacctttgcct
aataagatggtgaacgtgactggatggggtgcgcttagggaaggtggatcgacttctgca
cagttgatgaaagtatcggttccgatagtgagcaaatcagagtgtggagatgcttacaag
tacatgaacgagatcaccgatagaatgttatgcgccggttacacctcaggtggaaaggat
gcctgccaaggtgactctggtggacctttgacgggtgatgggatcctgtatgggctagtg
tcctggggctatgggtgcgccaaacccaattatcctggtgtttacaccaacgttgctaat
ctgcggtcctggatcaaggctcacagtggagtttaa

DBGET integrated database retrieval system