KEGG   Bombus terrestris (buff-tailed bumblebee): 100648879Help
Entry
100648879         CDS       T04364                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
Enzymes [BR:bter01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100648879
Peptidases [BR:bter01002]
 Metallo Peptidases
  Family M2
   100648879
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100648879
CD molecules [BR:bter04090]
 Proteins
  100648879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 674 aa AA seqDB search
MKNDFERDQRHLHFICLIFGSTLTMTKMRILRKLIGIVIICSLMQRSCSKYLEGMNVNLG
DAVQFLREYDSEASAMCTRVMTAQWNFATNVTEENRRKMIEEQTLKLKFDRISWRKAVSF
AWSRIGDPFAKRELKMIAIRGRNSLTDDKFNELHSLILEMKEIYVRTRVCPYRTIGANCD
LNLDHDVNKIMAKSKDYDELLYYWHAWHEATGPQLKNKYMRYIQLANQAARLNGFEDAGD
QMRELFEDEYFRQNTADVMSAITHLYKNLFTYVRTKLFERYGDKIRRDGPIPAHILGNMW
AQNWEDLFDLVQPFPASKKLDVTLEMMIRRFTPLRMFQIAEEFFTSLGMKPMPPEFWRFS
MFEKPIDREVKCTPSAWDFCNRMNYSIKQCTRVTMEDLLSTHHEIARLQYFLQYSDQPLL
FRNEAIPGFFEAVSDAIELSVFTPQHLSKLELHDNSTDDYGSDINFLMLMALRKVAYMPF
AYIVDEWRWRVFNEGVTDMTNKWWELRLQYQGIVPPVPRSERDFDPGSKYHIPADALYAK
YFVGVVLQFQLFESLCEIAGHTGDLHTCDFYRSREAGRLLSDVLSIGSSRSWKDVVRQMT
RGRTNRMDASAILRYFEPLNKWLKRQNEMEPVVGWITNRDDTALFFHWYQNGARKITSQL
FIPLALISMRISIC
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgatttcgaaagagatcaacgacacttgcactttatttgtcttatttttggc
tccactttaactatgacaaaaatgaggattctcaggaaattgattggtatagtgattatt
tgttcccttatgcagagaagctgtagcaagtatttagagggtatgaacgtgaatttaggg
gatgctgtacaatttcttcgagaatatgacagtgaagcttctgcaatgtgcacgagagta
atgacagcgcaatggaattttgcaacaaatgttactgaagaaaatcgtcgaaaaatgata
gaagaacagactttgaagttgaaatttgaccgaatttcgtggcgcaaggctgtcagtttc
gcttggagtcgaataggagatcccttcgctaaaagggaactcaagatgatcgctatcagg
ggacgaaattctttgacagatgacaaatttaatgagttgcacagtctgattctcgaaatg
aaggaaatatatgtgcgaacaagggtgtgtccttacagaacgataggagcaaattgtgac
ctgaatttagaccatgatgtgaataaaataatggcaaaatctaaggactatgatgaatta
ttatattattggcatgcttggcatgaagctactgggcctcaacttaaaaataaatacatg
agatacattcaactagcaaatcaagctgctagactaaatgggtttgaggatgcaggtgat
caaatgagagaattgtttgaagacgaatactttcgacagaacacagcagacgtaatgtca
gcgatcacgcatttgtacaaaaatctctttacttatgtaagaacgaaattattcgaaaga
tatggcgataaaataagaagggatggaccaattccggcgcatattttaggaaatatgtgg
gcacaaaattgggaagatctcttcgacctagtacagccatttccagcaagtaaaaaatta
gacgtcactttggaaatgatgattcgaagattcacaccgttgaggatgttccaaatagca
gaggaattctttacttctcttggaatgaagccaatgccacctgaattctggagattctcg
atgtttgagaagcctatcgacagggaagtcaagtgtactcccagtgcttgggatttttgc
aataggatgaattacagcattaagcagtgtacgagggttacgatggaagatttactatca
acacaccatgagatcgctcgattgcaatacttcttacaatatagcgatcaaccattatta
tttcgaaacgaggcaattccaggatttttcgaagcagtcagtgacgccattgagctttcc
gtgttcacccctcaacatttaagtaaactcgaattacatgataattctacggatgattat
ggaagcgatatcaatttcttgatgttaatggcacttcgtaaagttgcctacatgccattt
gcgtacatagttgatgagtggaggtggcgtgtattcaacgagggtgttacggatatgaca
aataaatggtgggaattaagattgcagtatcaaggaattgtgcctccagtaccacgatct
gaaagagattttgatcctggatcgaagtatcatatcccagctgacgctctttatgccaaa
tattttgttggtgttgtcttgcaatttcaattgttcgaatctttatgtgaaatagcaggc
cacactggtgatttacatacttgtgatttttatagatcaagagaagctgggagattatta
tccgatgtgctatcaattggttcgtccagatcttggaaagatgtggtacgacaaatgaca
agaggtagaacaaacaggatggatgctagtgctatattaagatatttcgagcccctaaat
aaatggctaaaacgacaaaatgaaatggaacctgttgttggttggatcacaaatcgcgat
gacacagcgttgtttttccactggtaccaaaatggcgctcgaaaaatcacctcacagtta
ttcatcccactggctttgattagtatgcgaatctcaatatgttaa

DBGET integrated database retrieval system