KEGG   Bombus terrestris (buff-tailed bumblebee): 100650014Help
Entry
100650014         CDS       T04364                                 

Definition
(RefSeq) serine protease 53-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
Enzymes [BR:bter01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100650014
Peptidases [BR:bter01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100650014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 547 aa AA seqDB search
MLRLTALLAFVALVAANPITNQTVHHFVQRMDGRIVGGEETTIEAAPYQVSLQHNGRHFC
GGSIISKNWVVTAGHCTDFPASGYLIRSGSTNVNSGGSVHRVQQVIRHENYGSDRHGIPS
NDVALLRVVDSDAFQFNNARKPISLYQGSPDALVNKYGLITGWGTTETGKLPLRLRKVSV
PIISRPSCNEAYREVGGIPQWEICAGVAKGGKDSCQGDSGGPFVVNGKLVGIVSWGMGCG
TPKYPGVYTDVSHYGSWIKQHARIIHRKFCRKADKHCNSLASKMFTQLSLLALLAAATAT
PPLQRPILNSLFPTGQIIGGTNARIEDVPHQVSLQSSGLSFCGGSIISDKWVITAAHCMS
YPPEWITVKAGTATKSIGGSTHKVAEIIVHENYTTNWRGVPRNDVAVLRVSNPFTLDKTR
NPIKIFKQNEESAVGITATITGWGATREGGNTAEILKTVDVPIVSKSSCNEAYKSYGGLP
EGQICAAIPEGGKDACQGDSGGPMTIGGRLAGLVSWGYGCARPGYPGVHTEVAAFSDWII
SKTGIKA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctcaccgcccttctcgcttttgttgccctagtggccgcgaacccgataaca
aaccagacggtgcaccacttcgtccagcgaatggacggtcgcatcgttggtggcgaggaa
acgaccatcgaggcagcgccgtaccaagtgagcttgcaacacaatggtcgccatttctgc
ggaggtagcataatctccaagaactgggtggtaaccgctggacattgcaccgattttcca
gccagcggctacctcatacgttccggctcgaccaacgtcaattccggtggttcggtgcac
cgagttcagcaagtgatcagacatgaaaactatggcagcgatcgtcacggtatcccatcg
aacgatgtcgccctgcttcgtgtggtagactctgacgcgttccaattcaacaacgccagg
aaacctatatcgctgtatcaaggaagccccgatgctcttgttaacaaatacggattgatc
accggttggggtaccaccgaaaccggtaagcttccgctgcgtctccgcaaggtttcggtt
cctataatctcgagaccgtcgtgcaacgaagcgtacagggaggtcggaggaattcctcaa
tgggaaatttgcgctggagttgcgaagggaggcaaagactcttgccaaggtgactctggt
ggcccctttgttgtcaatggcaaactcgtgggaatcgtctcttggggtatgggctgcgga
actcctaagtatccaggcgtttacaccgacgtttcccactatggctcatggatcaaacaa
cacgctcgtattatacaccgcaaattttgtagaaaggcagacaaacattgcaactccttg
gcaagcaagatgttcacacaactgagtttactcgccttgttggctgccgcgacagcgacc
ccgccgctgcaaagaccgatcttgaactccctatttccaaccgggcaaatcatcggtgga
acgaacgcaaggatcgaggacgtaccgcaccaagtgtcccttcaaagttccggcttaagc
ttctgcggcggtagcatcatttcggacaaatgggtgataacagctgctcactgcatgtct
tatccacccgaatggatcaccgtgaaagccggaacggcgaccaaatccatcggcggaagc
acacacaaggtagctgaaataatcgtccatgagaactatacgacgaattggcgcggagta
ccaaggaacgacgtagccgtgctacgagtttcaaatcctttcacgttggacaaaacgcgt
aatcctatcaagatcttcaaacaaaacgaagaatccgccgtgggaatcaccgcgacaatt
accggatggggtgcgacgagagaaggcggtaacactgccgagatccttaaaactgtcgat
gtacctatcgtatcgaagagctcctgtaacgaagcctacaaatcatacggagggttgccc
gagggacaaatctgcgcggcgataccagaaggaggaaaggacgcttgccaaggggactct
ggcggccccatgactattggtggacgtttggctggcctagtgtcctggggttacggttgc
gccagacctggctaccctggtgttcacacagaggttgctgccttcagcgattggatcatc
tccaagactggaattaaagcgtga

DBGET integrated database retrieval system