KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_01260Help
Entry
YBT020_01260      CDS       T01839                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00473  D-Alanine metabolism
btf00550  Peptidoglycan biosynthesis
btf01100  Metabolic pathways
btf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    YBT020_01260 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YBT020_01260 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    YBT020_01260 (ddl)
Enzymes [BR:btf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     YBT020_01260 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:btf01011]
 Precursor biosynthesis
  Amino acid ligase
   YBT020_01260 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADY19504
UniProt: F0PTA2
LinkDB All DBs
Position
249958..251043
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEVLKMSGAENAISPLSLSTEIIPSANAEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASAAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKDRETAYEKVEEVLGYPC
FVKPANLGSSVGINKCKNREELENAFEEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIVAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAMERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ctacaaacggctcttgctgctattaaagcattaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatgggtacgcggtgagcgtattgaaggtgaagtaaca
gatgttgaagttctaaaaatgagcggtgcagaaaatgcgatttctccgctatcattaagc
acagaaatcattccatctgcaaatgctgaggaaaatgctatcgacgttattttcccatta
ctacatggaccaaatggtgaagatggaacggtacaaggattattagaattaatgaatatt
ccttatgtaggaaatggtgttctagcatctgctgctggtatggataaagttgttatgaaa
aacatctttgcagaagctggattgaaacaagcaaaatatgcatcatttattcgtagtgca
tgggaaaaagatcgtgaaacagcatatgaaaaagtagaagaagtattaggttacccttgc
ttcgtaaaaccagcaaaccttggttcaagtgttgggattaataagtgtaaaaatcgtgaa
gaacttgagaatgcatttgaagaggcattccaatttgatcgtaaaattattgtggaagaa
aatatcgttggacgtgaagtagaagttggtgtactaggtaatgatgaaccgaaatgttca
gttgtaggtgaaatcgtacctaaaaaagacttctatgattataagtcgaaatacatcgat
ggtgatacagcgttaattattccagctgaaatgacagaagaagagtctaatgttattaag
cgagatgcgattgttgcattccaatcgttagatggtgctggcttaacgcgagctgatttc
ttcttaacgaaagatggagaagtatacattaacgaagtgaatacgatgccaggatttacg
ccgtttagtatgttccctctactatggcaacatactggattaccgtatccagaattaatt
gaagagctaattcgtttagcaatggagcgtcacgaagaaaaacaaaaaattaaatataca
atctaa

DBGET integrated database retrieval system