KEGG   Burkholderia thailandensis 2003015869: DR62_2340Help
Entry
DR62_2340         CDS       T03763                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:btha00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DR62_2340
Enzymes [BR:btha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DR62_2340
Transporters [BR:btha02000]
 Other Transporters
  Pores ion channels [TC:1]
   DR62_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIP62776
UniProt: A0A2N8R072
LinkDB All DBs
Position
1:2254351..2255007
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLIEHGIPFDETLVNVPIKDPACFADTPLGKVPYLLTERGAL
SESQAIVEYLAASHPDKRIFPADPFDAAKAREIMTVLELYVEWNARELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLARFSPYVLGDTFCIADIAAFVHFPITALATKAIYGRDFIA
DAGIDWKSYVKRIEEERPAAKRVSEERKAFIAGLAKQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgtgtggttttcccgtgtccaattactacaacaaggtcaagttcgtcctg
atcgagcacggcattccgttcgacgagacgctcgtcaatgtcccgatcaaggatcccgcg
tgcttcgccgacacgccgctcggcaaggtgccgtatctgctgaccgagcgcggcgcgctc
agcgaatcgcaggcgatcgtcgaatatctcgccgcgagccacccggacaaacgcattttc
ccggccgacccgttcgacgccgcgaaggcgcgcgagatcatgacggtgctcgagctgtat
gtcgaatggaacgcgcgcgagctgtttccggaggcattcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctcgacggcttcaagcggctt
gcgagattctcgccttacgtgctcggcgatacgttctgcatcgccgacatcgccgcgttc
gtccattttccgatcaccgcgctcgcgacgaaggcgatttatggccgcgatttcatcgcc
gacgccgggatcgactggaagtcatacgtgaagcgcatcgaggaggagcggccggccgcg
aagcgagtgagcgaggagcgcaaggcgttcatcgcggggctggcgaagcagggttga

DBGET integrated database retrieval system