KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_03405Help
Entry
BTK_03405         CDS       T03473                                 

Definition
(GenBank) neutral protease
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Brite
Enzymes [BR:bthi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BTK_03405
Peptidases [BR:bthi01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BTK_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
694287..695987
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKFNTIDHVTNDDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHYYAGITYDYYKNTFNRNSINDAGAPLKSTVHYGSNY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSNLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVNGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVAAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagagtttagcattagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcgtttgcggattctaaaaatgtgctctctactaagaagtacaatgag
acggtgcagtcacctgagtttatttctggtgatctaactgaagcaactggcaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcacaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtgcctgtatggggttctactcaagtagct
cacgtaagtaaggacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaagtagaaccaaaagcggacttatatgta
tatcaaaacggtgaggaaacaacatatgcatatgttgtaaatctaaacttcttagatcca
agcccaggaaactactactatttcattgaggcagacagcggtaaagtattaaataagttt
aatacaattgatcatgtgacgaatgatgataagtcaccagttaagcaagaggctcctaaa
caggatgcgaaagctgttgtaaagcctgtaacaggaacgaataaagtaggaactggtaaa
ggcgtactaggagatacgaagtctcttaatacaacgttatctggatcatcttactactta
caagataatacacgcggggcaacgattttcacatatgatgcgaaaaaccgttcaacatta
ccaggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcagcg
gtagatgctcattactatgcgggtatcacgtatgattactataagaatacatttaatcgt
aattcaattaatgatgcaggagcgccgttaaaatcaacagttcattacggaagtaattat
aacaatgcattctggaacggatcacagatggtatacggagatggtgatggtgtaacattt
acttcattatctggtggaattgatgtaattggtcacgagttaacgcatgctgttacggaa
aatagttcaaatctaatttatcaaaatgaatcaggggctttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccggattgggagattggtgaa
gatatttacacacctggtaaagcaggagacgcgcttcgctctatgagtgatcctacgaag
tatggtgatccagaccattattctaagcgttacactggttcaagtgataacggtggcgtt
catacaaacagcggcattattaataaacaagcttatttattagcaaatggcggtacgcat
tacggtgtaactgtaaatggtatcggcaaagataaattaggtgcgatttactaccgtgca
aatacacagtatttcacgcaatctactacatttagtcaagctcgtgctggtgcagtacaa
gctgcagcagacttatatggtgcaaattctgctgaagtagcagcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system